DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4892 and cdv3

DIOPT Version :9

Sequence 1:NP_609778.3 Gene:CG4892 / 34949 FlyBaseID:FBgn0028884 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_005162619.1 Gene:cdv3 / 334102 ZFINID:ZDB-GENE-030131-6034 Length:237 Species:Danio rerio


Alignment Length:230 Identity:62/230 - (26%)
Similarity:90/230 - (39%) Gaps:59/230 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLDDFFAKKDNKKTKKKKPNYLATDELYKTLEE-SAKLATDADSVKSMENENRTEGPTESTGSAM 66
            ||||||||:|.||.|:|.          |..|: :...|..|..||.|:.|......:|:..:.|
Zfish    12 SLDDFFAKRDKKKKKEKG----------KGKEQVTGAAAAAAMPVKKMKKEKEKSTKSENQDAQM 66

  Fly    67 KSLEFSLLYPNESVKEEDEWSEFTEENRMELMSLGHSSGSTILTQLAVGDVKAQDS-EQTDTGGD 130
            :             ||::||.|| |:..::...|.       |..:.:.|.|.::. |:.:.|.|
Zfish    67 E-------------KEDEEWKEF-EQKEVDYTGLR-------LQAMQMSDEKEEEEYEKEEVGED 110

  Fly   131 GMNVGQKHDDDIGNTTCPWVKMEHALEQQKLKEPMSVEQPNKKEPSEVKSQIYIPPALRQSQGDF 195
            |..:....|...|    ||.|...|...........||.|..|.|.     :|.||..|.     
Zfish   111 GEIILVTSDKMSG----PWNKSGGAPPSAASAPVEEVEVPEPKAPG-----VYRPPGARL----- 161

  Fly   196 NRRDQAESRLRKVPSKMSGKPQAPDLNSDEYFPSL 230
                   :..:|.|::     ..|::.||..||||
Zfish   162 -------TTTKKAPAQ-----GPPEIFSDAQFPSL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4892NP_609778.3 CDV3 82..233 CDD:405941 38/150 (25%)
cdv3XP_005162619.1 CDV3 69..187 CDD:292003 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16284
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.