DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-VI

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster


Alignment Length:275 Identity:90/275 - (32%)
Similarity:135/275 - (49%) Gaps:32/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALTTILLALTLEMTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPK 75
            ||:.|:::..|.....|:|:::.||.||.....|.|.|.||:|..:||:|:||.|:.|||||.|:
  Fly    36 ALSWIIISELLLSAHCLKDLKIFVPEAVLMGNAATLSCQYDLEQAALYAVRWYFGQEEFYRYVPR 100

  Fly    76 ETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPH 140
            |..|..||...|:.|...:|:.:.|.|..||...||.|.||||.|||.|||.|.:|.::|||.|.
  Fly   101 EAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQVIELPK 165

  Fly   141 NAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARNDMET--- 202
            :.|.:...:....|.|..:..||...|.|.||:||::|..::....::  :|.:|......|   
  Fly   166 DDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQ--RISQDTYEGSTTYSS 228

  Fly   203 --------AVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEKII---------LETDLFPKH 250
                    |:.|. |....||    .:.|:|...:..:|.|...:.|         :..:|....
  Fly   229 LDIYPNSQALQGF-FETKYQH----SVNLQCVVTIRHMYHKVVAQRIGLNAAPPTTISPNLLGLE 288

  Fly   251 GNG--ANGNHVNPDD 263
            |:.  |||   :||:
  Fly   289 GSKRYANG---DPDN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 38/85 (45%)
Ig 161..240 CDD:299845 21/89 (24%)
beat-VINP_001263035.1 Ig 66..142 CDD:416386 33/75 (44%)
Ig strand B 67..76 CDD:409353 3/8 (38%)
CDR1 76..83 CDD:409353 2/6 (33%)
Ig strand C 83..91 CDD:409353 4/7 (57%)
FR2 84..91 CDD:409353 3/6 (50%)
CDR2 94..108 CDD:409353 7/13 (54%)
Ig strand C' 94..99 CDD:409353 4/4 (100%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 12/33 (36%)
Ig strand D 117..121 CDD:409353 0/3 (0%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.