DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-Vb

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:109/253 - (43%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLALTLEMTAALRDVR------VRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTP 74
            ||.|.:.|...:|.::      :.||..|...:...|.|.|||...:|.||||||..:||:||:|
  Fly     7 LLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSP 71

  Fly    75 KETPPMKV-FHFPGVKV----RRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134
            . |||..: |...||::    ...:.:..:|.|:.:.:.:||.|.||||.|||.|......|.:.
  Fly    72 L-TPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMT 135

  Fly   135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARND 199
            |...|.|.|.|:.....||..|.:..||::..|.....:||.||..:|:         |.|....
  Fly   136 VEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVS---------LVDLLPS 191

  Fly   200 METAVVG-----------IHFVVTDQHFDNGK-----------------LKLRCSAQL 229
            .||.:|.           ::|...:..|...:                 |:|||.|::
  Fly   192 FETTIVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLGLELRCVAEI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 33/90 (37%)
Ig 161..240 CDD:299845 20/97 (21%)
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 32/82 (39%)
Ig 41..130 CDD:143165 36/89 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.