DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-Va

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:271 Identity:81/271 - (29%)
Similarity:120/271 - (44%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTTILLALTLE--MTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTP 74
            |..:.:||.::  :..||....:.||..|...:...|.|.||:...:|.||||||...||:||:|
  Fly     6 LMFLFIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFRYSP 70

  Fly    75 KETPPMKVFHFPGVKV--RRVSSNESQVVLDAVTMA--TSGKYSCEVSADAPSFHTLIAAAELEV 135
            ..:|....|...|::|  .:...|||...||.....  ::|.|.||||.|||.|.....|..:.|
  Fly    71 LTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLADKADNMTV 135

  Fly   136 IETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEE---------VNPALVRHHK 191
            ...|.|.|.|......||:.:.|:..|.|..|.....|||.:|.|:         .:.:|..|..
  Fly   136 AALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTTDTSLAAHDY 200

  Fly   192 ILRDARNDMETAVVGIHFVVTDQHFDNGK-LKLRCSAQLHDV----YWKTTEKIILETDLFP--- 248
            :||..|..::..:.|..|      |..|| |:|:|.|::.:.    ..||....:.:.|.|.   
  Fly   201 VLRRQRLQVQFFLQGQRF------FQAGKILELKCVAEIENYPELRREKTLSASLSQYDNFNNQM 259

  Fly   249 --KHGNGANGN 257
              :|.|..:|:
  Fly   260 PLRHANANSGS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 32/89 (36%)
Ig 161..240 CDD:299845 24/92 (26%)
beat-VaNP_001189214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.