DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and CG5597

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:159 Identity:41/159 - (25%)
Similarity:65/159 - (40%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EKAILKCFYDIEDDSLY-SVKWYKGRREFYRYTPKETPPMKVFHFPG-VKVRRVSSNE-----SQ 99
            |..||.|.|::|:...: :||||:..:..|::. ..|||..:..|.. :.....||.|     |.
  Fly    40 EPTILDCDYEVEESPKFITVKWYRDDKSIYQWI-FGTPPYAIPEFRNEIDSTYESSTEPSKQYSS 103

  Fly   100 VVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIE-----------TPHNAPFITGIRPRYR 153
            :.|...|:||:|.|.|.|..   |.:|..:...::||:           |.||...:        
  Fly   104 LALINPTIATTGDYKCVVQT---SLNTFSSHQRVQVIDLRNYTLELSHKTIHNETQL-------- 157

  Fly   154 VGDILRGNCTSRHSRPAANLTWTVNNEEV 182
                   |||..:..|...:|...|:.:|
  Fly   158 -------NCTVTNVYPRPTITIISNDMDV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 26/82 (32%)
Ig 161..240 CDD:299845 7/22 (32%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.