DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-IIIc

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster


Alignment Length:431 Identity:127/431 - (29%)
Similarity:208/431 - (48%) Gaps:80/431 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TILLAL----TLE--MTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRY 72
            ::|.||    ||:  ..|.||...||:|..|.:...|.|:|.||::.::||||||||...|||||
  Fly     6 SLLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRY 70

  Fly    73 TPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIE 137
            .|::.||.:.|..|||.|...:|:::.|.|..|.:.::|::.||||.:||||.|:....::.|..
  Fly    71 VPRDMPPAQTFLLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAY 135

  Fly   138 TP-HNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARNDME 201
            .| ..:|.|:|.||||::||.:|.|||:..|:||..|:|.||.|.|....:|.:..:...|:.:|
  Fly   136 LPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVSGRDGLE 200

  Fly   202 TAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEKIILETDLFPK----------HGNGANG 256
            |:|:|:.|.|..:||..|.:||:|.|:|..|||:..|:.: |.|...|          :.:.:..
  Fly   201 TSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESV-EGDRPQKAPVLESRETVYASNSRA 264

  Fly   257 NHVNPDDFYDQYALHEDHLHNKKNSYLTQLQEFFFYHFVPSGEEDDGTEGGLGDGGAAWRGAGSS 321
            :.|....:              :..::|::....|..  |:               ||...|.:.
  Fly   265 DPVQGTSY--------------RELFVTKILSLLFVQ--PN---------------AASSTASAP 298

  Fly   322 SSRLSPSSSQSCWMVGGSLMAVLSWTLARQLVSPLQAMMTKTGGATCNM-SGRCASRRTRAHGMR 385
            |:.::|             :.:|...||      :..|.|...|.|.:: :.:.:..||...|  
  Fly   299 STPITP-------------LVLLPVALA------VMVMATLAQGITRDIDTDKISMDRTAPGG-- 342

  Fly   386 VSATKQKQKQRQM---------QQEHRKSCLRVSKSSWKGR 417
            :..||:.|:.|::         :..|.||..::.|.:...|
  Fly   343 IGITKETQQARELLAGRKEENRRTSHGKSATQLEKIALTAR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 37/85 (44%)
Ig 161..240 CDD:299845 32/78 (41%)
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 42/93 (45%)
Ig 42..127 CDD:143165 40/84 (48%)
Ig 140..219 CDD:299845 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108442at50557
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.