DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-Ib

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:274 Identity:125/274 - (45%)
Similarity:171/274 - (62%) Gaps:29/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTTILLALTLEMTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPKE 76
            :|.|.:|....:|..||:|.||:|.||:|.:.|:|.|.||||:|:||:||||:||||||||||||
  Fly    14 ITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFYRYTPKE 78

  Fly    77 TPPMKVFHFPG-VKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPH 140
            .|..|:|.... :.|....||.|.|:|..|..:.|||::||||||||:|.|.|.||::||:|.|.
  Fly    79 NPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPT 143

  Fly   141 NAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARNDMETAVV 205
            ..|.||||..|||:||::.|||:|.:|:|||||||.:|:.:|.|..:|.:.|.|.....:|:||:
  Fly   144 QRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVAEHLESAVL 208

  Fly   206 GIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEKIILE--------------------------- 243
            .|.||||..||...:|||:|||::|::|.:.:||:|.|                           
  Fly   209 EIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDRPRILASGRSPDMNMYPFDQPGDADE 273

  Fly   244 -TDLFPKHGNGANG 256
             .:||..|.|.|.|
  Fly   274 HNELFLIHSNAACG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 47/86 (55%)
Ig 161..240 CDD:299845 36/78 (46%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 12/21 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469212
Domainoid 1 1.000 175 1.000 Domainoid score I7543
eggNOG 1 0.900 - - E1_2A48N
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D78626at33392
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.