DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and f11r.2

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001076451.1 Gene:f11r.2 / 100005566 ZFINID:ZDB-GENE-060531-67 Length:294 Species:Danio rerio


Alignment Length:269 Identity:61/269 - (22%)
Similarity:98/269 - (36%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTTILLALTLEMTA--ALRDVRVRVPHA-VRRSEKAILKCFYDIEDDSLYSVKW----YKGRREF 69
            ||.:.:.|:..:|.  |...|.|..|.. |:.:|...|:|.|..:..:...|:|    .||.:.|
Zfish     2 LTLVFVCLSFSLTGLHASFSVAVNGPIVKVKENEGVDLQCSYTADFGATPRVEWKFRNLKGFQYF 66

  Fly    70 YRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134
            ..:..|.|...:         :|::.....:....||.|.:|.|:||||.:.......|..    
Zfish    67 IYFNNKPTVEYE---------QRITVYAGGLRFQKVTRADAGDYNCEVSGNGGYGENTIKL---- 118

  Fly   135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEV--NPALVRHHKILRDAR 197
            |:..|.:.| ::.|......|..:|..|......|.:...|..:|..:  :|......|.|....
Zfish   119 VVSVPPSKP-VSSIPSSVTTGSNVRLTCFDPVGSPPSTYEWYKDNNLLPEDPTKFPIFKNLTYKM 182

  Fly   198 N----DMETAVV-----GIHFVV------TDQHFDNGKL-------------KLRCSAQLHDVYW 234
            |    ::|...|     |.:|.|      ..||.|..|:             |...|.:.|::..
Zfish   183 NAFNGNLEFLSVSKWDAGSYFCVASNENGVSQHGDAVKMEVYDVDSSQVLDVKSNLSMETHNIPG 247

  Fly   235 KTTEKIILE 243
            |.|...|:|
Zfish   248 KITNSHIME 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 22/90 (24%)
Ig 161..240 CDD:299845 22/108 (20%)
f11r.2NP_001076451.1 Ig 29..120 CDD:299845 23/103 (22%)
IG_like 29..120 CDD:214653 23/103 (22%)
Ig_2 132..212 CDD:290606 15/79 (19%)
IG_like 134..216 CDD:214653 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.