Sequence 1: | NP_001285975.1 | Gene: | beat-Ia / 34947 | FlyBaseID: | FBgn0013433 | Length: | 437 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076451.1 | Gene: | f11r.2 / 100005566 | ZFINID: | ZDB-GENE-060531-67 | Length: | 294 | Species: | Danio rerio |
Alignment Length: | 269 | Identity: | 61/269 - (22%) |
---|---|---|---|
Similarity: | 98/269 - (36%) | Gaps: | 51/269 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LTTILLALTLEMTA--ALRDVRVRVPHA-VRRSEKAILKCFYDIEDDSLYSVKW----YKGRREF 69
Fly 70 YRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134
Fly 135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEV--NPALVRHHKILRDAR 197
Fly 198 N----DMETAVV-----GIHFVV------TDQHFDNGKL-------------KLRCSAQLHDVYW 234
Fly 235 KTTEKIILE 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
beat-Ia | NP_001285975.1 | Ig | 32..118 | CDD:299845 | 22/90 (24%) |
Ig | 161..240 | CDD:299845 | 22/108 (20%) | ||
f11r.2 | NP_001076451.1 | Ig | 29..120 | CDD:299845 | 23/103 (22%) |
IG_like | 29..120 | CDD:214653 | 23/103 (22%) | ||
Ig_2 | 132..212 | CDD:290606 | 15/79 (19%) | ||
IG_like | 134..216 | CDD:214653 | 16/81 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |