DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and AT5G23680

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_197757.1 Gene:AT5G23680 / 832433 AraportID:AT5G23680 Length:295 Species:Arabidopsis thaliana


Alignment Length:346 Identity:80/346 - (23%)
Similarity:117/346 - (33%) Gaps:99/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 MVAGGQSNNGNYLQVPGAVAPPLKPPTVSPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTV 622
            :|.|.|.|.|   .:|.|:...::.|          .||.....|..:..|.:   |..:|    
plant     6 LVEGHQINGG---FIPPAIINSIEAP----------ETSAAAGVSVGSKRLRR---PSVRL---- 50

  Fly   623 SSTSSSTAGSQNRAHY-----SPDSTYGSEGGGVGGGGGGGAR------LGRRLSDGVLLGLSN- 675
                ....|.|...|.     ||...........|||||||.|      .|:..|......::| 
plant    51 ----GDIGGDQYHQHVVAAYDSPQVRRPKWRPSGGGGGGGGNRKEPNNQSGKTTSSSRTRTMTNL 111

  Fly   676 SNGGGGNSGGAHLLPGSAESYRSLHYDLGGNKHSGHRAFDFDMKRALGYKAMERTPVAGELRTPT 740
            |:||..|:|.....|.|..|:|...:    .|.||                       ||....|
plant   112 SSGGYENTGTLDEDPVSIGSWRVKKW----VKSSG-----------------------GETAATT 149

  Fly   741 TAWMGMGLSSTSPAPAPLENGENGAAGGGASSGWRLPPG----------LGSPYGLSATTGLLDA 795
            |         |:.|.|............|...|.....|          ||...|....:.....
plant   150 T---------TNTASAKRVRSNWATRNDGVEQGDEKFSGEEEEEEEDEELGGEEGFRDFSREDSE 205

  Fly   796 TPVNRRMQLAKHKDIQTL----------------LTSLGLEHYIKIFVLNEIDLEVFTTLTEENL 844
            :|:..|.:. ::::::.|                |..|||..|..:|.::|:|.:|...||.|:|
plant   206 SPMKERRRY-ENREVELLGDWQSGGRGKEGVKIWLQELGLGRYWPMFEMHEVDEQVLPLLTLEDL 269

  Fly   845 MELGIAAFGARKKLLTAIHTL 865
            .::||.|.|:|:|:..||..|
plant   270 KDMGINAVGSRRKMYCAIQKL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087
vigilin_like_KH 327..393 CDD:239087
SAM_BICC1 805..868 CDD:188919 23/77 (30%)
SAM 807..867 CDD:197735 23/75 (31%)
AT5G23680NP_197757.1 SAM_superfamily 235..289 CDD:188886 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4374
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004093
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10627
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.