DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and AT3G48800

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_190449.1 Gene:AT3G48800 / 824041 AraportID:AT3G48800 Length:278 Species:Arabidopsis thaliana


Alignment Length:364 Identity:75/364 - (20%)
Similarity:111/364 - (30%) Gaps:159/364 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 GQSNNGNYLQVPGAVAPP-----------LKPPTV---------------SPRNSCSQNTSGYQS 600
            ||..||..:.:|.:.:..           |:.|:|               ....:.:.::.|.:|
plant     9 GQQTNGGVVTIPASTSAEATAIAAAGSKRLRRPSVRLGEIGGDQYQQQHHHHAAAAAYDSQGRKS 73

  Fly   601 -FSSSTTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPDSTYGSEG-------GGVGGGGGG 657
             ::.:|||            |....||.|   |:.|...:..|.|.:.|       |.|...|.|
plant    74 KWTPTTTS------------GNRKDTSKS---SRTRTLTNLSSGYENIGTLDDEREGNVDSFGVG 123

  Fly   658 GARLGRRLSDGVLLGLSNSN-----GGGGN--SGGAHLLPGSAESYR----------SLHYDLGG 705
            ..|:.:|:..........||     |.|..  |||..|..|..:..|          ||..|.||
plant   124 SWRVKKRVGSSAAAKRVRSNWVSKVGDGDEKISGGEELEGGFRDFSREDSESPIKEESLDRDGGG 188

  Fly   706 ---------NKHSGHRAFDFDMKRALGYKAMERTPVAGELRTPTTAWMGMGLSSTSPAPAPLENG 761
                     |..||:|.|:.:|                                           
plant   189 FYGRRRYESNNSSGNREFESNM------------------------------------------- 210

  Fly   762 ENGAAGGGASSGWRLPPGLGSPYGLSATTGLLDATPVNRRMQLAKHKDIQTLLTSLGLEHYIKIF 826
                 .||...|                                    ::..|..|||..|..:|
plant   211 -----DGGGKEG------------------------------------VKIWLQELGLGRYWPMF 234

  Fly   827 VLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTL 865
            .::|:|.||...||.|:|.::||.|.|:|:|:..||..|
plant   235 EIHEVDEEVLPLLTLEDLKDMGINAVGSRRKMFCAIQKL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087
vigilin_like_KH 327..393 CDD:239087
SAM_BICC1 805..868 CDD:188919 23/61 (38%)
SAM 807..867 CDD:197735 23/59 (39%)
AT3G48800NP_190449.1 SAM_superfamily 218..272 CDD:188886 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4374
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004093
OrthoInspector 1 1.000 - - oto4014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10627
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.