DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and AT3G11890

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001326444.1 Gene:AT3G11890 / 820362 AraportID:AT3G11890 Length:527 Species:Arabidopsis thaliana


Alignment Length:249 Identity:55/249 - (22%)
Similarity:89/249 - (35%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 DDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHE 264
            |.|..|...|  :...|....:|..|..:|........:..:..|.|...|..::  :||:..| 
plant    75 DSTFVHTVVP--SLPLPETPQSQAELRDALADTHFTTPVPTVVVPALPLPEQFIL--HKPETSH- 134

  Fly   265 TPYIKMIETKFNVQVIFSTRPKLHTSLVLVKGSEKESAQVRDATQLLINFACESIA-SQILVNVQ 328
                ..::.:..:.....|.| |||.:..:..:|..:.|...::|..:... |||| :.....:|
plant   135 ----SQVQFRDCIANTHKTTP-LHTVVHSLPVTEHSTLQKPTSSQSQVELR-ESIADTHGTTPLQ 193

  Fly   329 MEIS----PQHHEIVKGKNNVNLLSIMERTQTKIIFPDLSDMNVKPLKK-----SQVTISGRIDD 384
            .|||    |||..:.|...:.:.....|.|....|.|.|....:..|:|     ||..:......
plant   194 TEISSLPLPQHFVLQKPATSQSQADTHETTLLHTILPSLPVPELCTLQKPATSQSQAELRANTRK 258

  Fly   385 VYLARQQLLGNLPVALIFDF--PDNHNDASEIMSLNTKYGVYITLRQKQRQSTL 436
            ..|.....:.:|||...:..  |......:|             ||.|.|::||
plant   259 ATLVHAAAMPSLPVPEHYSLQKPSTSQSQAE-------------LRAKTRKATL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 8/39 (21%)
vigilin_like_KH 327..393 CDD:239087 18/74 (24%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
AT3G11890NP_001326444.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10627
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.