DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and hdlbpa

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:XP_005165995.1 Gene:hdlbpa / 794178 ZFINID:ZDB-GENE-030131-2032 Length:1272 Species:Danio rerio


Alignment Length:482 Identity:100/482 - (20%)
Similarity:192/482 - (39%) Gaps:134/482 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DIMNTTDTYVSWPCRLK---IGAKSK---------KDPH------------VRIVGKVDQVQRAK 159
            ::.|.|:..||.|.:|.   ||:|.:         ...|            |.|.|..::|::||
Zfish   652 ELANITEVEVSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPTEGSGIDAVTIRGPAEEVEKAK 716

  Fly   160 ERILSSLDSRGTR---VIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSN 221
            :::||..:.:.|:   |.::....|  |.::||:||.||:::.|.|...|.||.:.     :|.:
Zfish   717 KQLLSLAEEKQTKSHTVELRAKPEY--HKFLIGKGGGNIRKVRDSTGARIIFPTAE-----DKDH 774

  Fly   222 Q-VSLCGSLEGVERAR----ALVRLSTPLLISFEMPVMGPNKPQPDHETPYI-------KMIETK 274
            : :::.|:.|.|..|:    ||::....::..|.:       ..|.|...::       :.|..:
Zfish   775 ELITVIGTEEAVAEAQKELEALIKSLDNIVEDFMI-------VDPKHHRFFVARRGQVLRDIADE 832

  Fly   275 FNVQVIFSTRPKLHTSLVLVKGSEK--ESAQVRDATQLLINFACESIASQILVNVQMEISPQHHE 337
            :...::...|....:..|.:||::.  |:|:.|....:      |.:.:|  |.::..|..:.|.
Zfish   833 YGGVIVSFPRTAAQSDKVTLKGAKDCVEAAKKRMLEMI------EDLDAQ--VTMECVIPQKFHR 889

  Fly   338 IVKGKNNVNLLSIMERTQTKIIFPD-----LSDMNVK-----------------PLKKSQVTISG 380
            .:.|.....:..|.:....:|.|||     .:|.:|:                 |.|...:.:||
Zfish   890 SIMGPKGSRIQQITKDHNVQIKFPDREEQQQADASVQENGEANGEVKEPVDPTAPKKCDVIVLSG 954

  Fly   381 RIDDVYLARQQLLGNLPVALIFDFP-DNH-----NDASEIMSLNTKYGVYITLRQKQRQSTLAIV 439
            |.:....|.:.|...:||.:..:.| :.|     ...|.|..:..::.|.|.:...:.||.: |.
Zfish   955 RKERCEAAVEALKALVPVTIAVEVPFELHRYIIGQKGSGIRKMMDEFEVNIQVPAHELQSDI-IS 1018

  Fly   440 VKGVEKFIDKIYE----------ARQEILRL----ATPFVKPEIPDYYFMPK------------- 477
            :.|:...:|:..|          |.||...|    .|..|:|:     :.||             
Zfish  1019 ITGLASHLDRAKEGLLERVKELQAEQEDRALRSFKLTITVEPK-----YHPKIIGRKGAIISHIR 1078

  Fly   478 -DKDLNLAY-------RTQLTALLAGY 496
             |.::|:.:       :.|:|  :.||
Zfish  1079 HDHEVNIQFPEKNDENQDQIT--ITGY 1103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 20/70 (29%)
vigilin_like_KH 327..393 CDD:239087 16/87 (18%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
hdlbpaXP_005165995.1 vigilin_like_KH 155..216 CDD:239087
vigilin_like_KH 227..283 CDD:239087
vigilin_like_KH 300..360 CDD:239087
vigilin_like_KH 371..428 CDD:239087
vigilin_like_KH 442..501 CDD:239087
vigilin_like_KH 512..571 CDD:239087
vigilin_like_KH 586..647 CDD:239087
vigilin_like_KH 658..720 CDD:239087 14/61 (23%)
vigilin_like_KH 732..794 CDD:239087 19/68 (28%)
vigilin_like_KH 808..867 CDD:239087 10/65 (15%)
vigilin_like_KH 878..967 CDD:239087 16/88 (18%)
vigilin_like_KH 973..1034 CDD:239087 12/61 (20%)
vigilin_like_KH 1054..1115 CDD:239087 11/57 (19%)
vigilin_like_KH 1126..1188 CDD:239087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.