DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and SPBC28E12.02

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_595755.1 Gene:SPBC28E12.02 / 2540579 PomBaseID:SPBC28E12.02 Length:663 Species:Schizosaccharomyces pombe


Alignment Length:386 Identity:71/386 - (18%)
Similarity:137/386 - (35%) Gaps:87/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IMNTTDTYVSWPCRLKIGAKSKKDPHVRIVGKVDQVQRAKERILSSLDSRGTRVIMKMDVSYTDH 184
            ||....:::.:|...|.|.::..             :.:|.:|.||..:...:..:::  :....
pombe   332 IMEENSSFIRFPEYFKEGGETSP-------------ENSKVKIYSSSIANSEKTALRL--AKLAS 381

  Fly   185 SYIIGRGGNNIKRIMDDTHTHIHFPDS-NRSNPTEK-------SNQVSLCGSL---EGVERARA- 237
            .|:.|:....:    :|....:....| .|::..||       |:.||..||:   .|:....: 
pombe   382 KYVQGKTQFGV----EDNEDFLRVAGSWRRASTIEKGVSSSELSSIVSSTGSIVETNGIGEKMSF 442

  Fly   238 --LVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRPKLHTSLVLVKGSEKE 300
              |.:||.|                |......|.:|.....|:::      |.|:.:...|.|..
pombe   443 SPLKKLSIP----------------PTEFVAQIAIICMASGVEML------LKTNGIEYFGQENT 485

  Fly   301 SAQVRD-ATQLLINFACESIASQILVNVQMEISPQHHEIVKGKNNVNLLSIMERTQTKIIFPDLS 364
            .....| |:::...|. :|...|||    :|...:..:.:.||.|..|..:.::.:..:   ...
pombe   486 VPIAMDKASKIFYKFG-QSQWHQIL----LEAPTKDQDFISGKKNGKLDKVKQQCRFNL---KNG 542

  Fly   365 DMNVKPLKKSQVTI---SGRIDDVYLARQQLLGNLPVALIFDFPDN-HND-----ASEIMSLNTK 420
            |:...|...|..|:   |..::.|......:|...|..:.|..|:. |..     ..:|..:...
pombe   543 DILFCPQSTSIFTVDIYSDELERVIKGMNTMLLEFPAEMHFYVPEEIHKKLIGFRGEQIQRVTKL 607

  Fly   421 YGVYITLRQKQRQSTLA-------IVVKGVEKFIDKIYEARQEILRLATPFVKPEIPDYYF 474
            |..||..      ||..       ::::...||.:.::..|...::.|.. :..:||.|.|
pombe   608 YNSYIEF------STTPFDCYGHNVLIRTPSKFSENLWAVRSLFIKTAEG-LGYDIPKYLF 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 14/79 (18%)
vigilin_like_KH 327..393 CDD:239087 11/68 (16%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
SPBC28E12.02NP_595755.1 COG5166 1..663 CDD:227495 71/386 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.