DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and Gm382

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001028413.2 Gene:Gm382 / 211208 MGIID:2685228 Length:1250 Species:Mus musculus


Alignment Length:515 Identity:108/515 - (20%)
Similarity:202/515 - (39%) Gaps:141/515 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DSDWSDIRAIAMKLGVQNPDDLHTERFKVDRQKLEQLIKAESSIEGMNGAEY---------FFHD 119
            :|::| ||.....|||              .|..::|:...:::|    .||         |.|.
Mouse   463 ESNYS-IRIEGESLGV--------------HQAKKELLDLANNLE----EEYSQDIIIKHQFHHI 508

  Fly   120 IMNTTDTYVSWPCR------LKIGAKSKKDPHVRIVG---KVDQVQRAKERILSSLD----SRGT 171
            ::......|...|:      |.....::|...|:::|   :.::..:..|.:|:.:.    |...
Mouse   509 LIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYESEKCAQYLENMLTDIKENNYSISV 573

  Fly   172 RVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERAR 236
            .:|.|:      |..|||:|.:||::|.:.|:|.|.||..:.:     |.:..:.|..|..|.||
Mouse   574 PIIKKL------HKRIIGKGVSNIRKISEATNTKITFPPESCN-----SEEFIITGYPENCEIAR 627

  Fly   237 A-LVRLSTPLLISFEMPVMGP-------NKPQPDHETPYIKMIETKFNVQVIFSTRPKLHTSL-- 291
            . ::.|...|..:.|..::.|       ..|:   |.....:||....:.:.|   ||..::|  
Mouse   628 NWILSLQQELADTAEEEIIIPANLYKHLTNPK---ECLLNSIIEECGKIHLHF---PKGKSNLNK 686

  Fly   292 VLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIVKGKNNVNLLSIMERTQT 356
            :::.|:.:   .|..|...|:..:.|..|..  .:..:.|..::|:.:..||..|:..|.:.|.|
Mouse   687 IIIMGTIE---NVEKAKTKLLKLSEEEQAKN--YSETLHIKSKYHQFLLNKNGGNISKICDETGT 746

  Fly   357 KIIFPDLSDMNVKPLKKSQ--VTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSLNT 419
            .:.||:       |..|.|  :||:|..:.|...::||     ..|:.||   .|:..:.:.:|.
Mouse   747 CVFFPN-------PTNKDQETITITGTEESVKEVQKQL-----DDLVKDF---ENEVDDSILINR 796

  Fly   420 KY--------------------GVYITLRQKQRQSTLAIV------VKGVEKFIDKIYEARQEIL 458
            ::                    ||.||.....||:|...:      |:..:|.|.:|:|....  
Mouse   797 RFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVEAAKKHIKEIFEPLGS-- 859

  Fly   459 RLATPFVKPEIPDYYFMP--------KDKDLNLAYRTQLTALLAGYVDSPKTPSLLPPSL 510
            ::.|.:|.|    :.|.|        :.:.:...|:.::           |.|.:..|:|
Mouse   860 QITTRYVLP----HSFQPFIMGPISSRIQQIARDYKVEI-----------KFPDIEKPAL 904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 21/66 (32%)
vigilin_like_KH 327..393 CDD:239087 18/67 (27%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
Gm382NP_001028413.2 vigilin_like_KH 356..410 CDD:239087
vigilin_like_KH 426..485 CDD:239087 8/36 (22%)
vigilin_like_KH 496..558 CDD:239087 8/61 (13%)
vigilin_like_KH 570..631 CDD:239087 22/71 (31%)
vigilin_like_KH 642..704 CDD:239087 13/70 (19%)
vigilin_like_KH 716..777 CDD:239087 17/67 (25%)
vigilin_like_KH 791..851 CDD:239087 10/59 (17%)
KH-I 867..952 CDD:294072 8/53 (15%)
vigilin_like_KH 959..1020 CDD:239087
vigilin_like_KH 1042..1102 CDD:239087
vigilin_like_KH 1113..1174 CDD:239087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.