DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BicC and tofu-7

DIOPT Version :9

Sequence 1:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_498547.1 Gene:tofu-7 / 175988 WormBaseID:WBGene00022737 Length:279 Species:Caenorhabditis elegans


Alignment Length:213 Identity:42/213 - (19%)
Similarity:76/213 - (35%) Gaps:66/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ADVAKPPMVGLEVEAGSIGSL-----SSLHALPSTTSVGSGAPSETQSEIS------SVDSDWSD 69
            ||.:|...:  .:.|.::|::     .:|..|...|.......|.|..|:.      |.|::|::
 Worm    51 ADASKDYFI--RIPAFAVGAVVGKRGMTLRRLMYETQTECVLRSYTPEELDVASNEVSADAEWTE 113

  Fly    70 IRAIAMKLGVQNPDDLHTERFKVDRQKLEQLIKAESSIEGMNGAEYFFHDIMNTTDTYVSWPCRL 134
                    ..|| :|...|.....|:|:..|                   ::..||         
 Worm   114 --------QFQN-EDWFGEESTDTRRKITYL-------------------LVRATD--------- 141

  Fly   135 KIGAKSKKDPHVRIVGKVDQVQRAKERILSSLDSRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIM 199
               .:..|...:||...:|.||:..:.....::   |:::          .|::||||.:||.:.
 Worm   142 ---EQCVKLVRLRIAEIIDNVQKPWKTAEFEVE---TQMV----------GYLVGRGGRHIKTLR 190

  Fly   200 DDTHTHIHFPDSNRSNPT 217
            |....:|...|....:||
 Worm   191 DKFSVNIQISDPIPDDPT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 12/44 (27%)
vigilin_like_KH 327..393 CDD:239087
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
tofu-7NP_498547.1 KH 59..>110 CDD:197652 10/52 (19%)
KH_1 165..>216 CDD:278442 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.