DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and F11R

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:160 Identity:37/160 - (23%)
Similarity:63/160 - (39%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TEKDVGSHG---SQSGRSCICWISVVLLLILVPDFIEALKDVSVMIPQAVKRGSNALFTCNYDME 83
            |.:|.|::.   |:.|.:....:.|.|::::.|      ...:|.||.:...|:.|:.||: :.:
Human   100 TREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPP------SKPTVNIPSSATIGNRAVLTCS-EQD 157

  Fly    84 NDTLYSVKWYKGKREFYRYTPKENPAMKVFAMTSGLNVERNLSNQSHVV------LQSVPLNIS- 141
            ........|:|..                ..|.:.....|..||.|:|:      |...||:.| 
Human   158 GSPPSEYTWFKDG----------------IVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASD 206

  Fly   142 -GKFTCEISVEAPTFQTAMVSG--EMEVVE 168
             |:::||   ....:.|.|.|.  .||.||
Human   207 TGEYSCE---ARNGYGTPMTSNAVRMEAVE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 7/28 (25%)
Ig strand B 46..50 CDD:409538
Ig strand C 59..63 CDD:409538
Ig strand E 92..96 CDD:409538
Ig strand F 106..111 CDD:409538 0/4 (0%)
Ig strand G 121..124 CDD:409538 0/2 (0%)
IgI_2_JAM1 135..231 CDD:409542 26/115 (23%)
Ig strand B 149..153 CDD:409542 1/3 (33%)
Ig strand C 163..167 CDD:409542 0/3 (0%)
Ig strand E 195..199 CDD:409542 1/3 (33%)
Ig strand F 209..214 CDD:409542 2/7 (29%)
Ig strand G 224..227 CDD:409542 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.