DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and beat-IIa

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster


Alignment Length:286 Identity:99/286 - (34%)
Similarity:151/286 - (52%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDVGSHGSQSGRS----CICWISVVLLLILVPDFIE-ALKDVSVMI-PQAVKRGSNALFTCNYDM 82
            :.:.||.....|:    |:..:..||||.:  :.:| ||::|:::| |.||:||.:.:..|.||:
  Fly    32 RQIRSHRKSDCRTFPARCLLLLLGVLLLSM--ELVECALRNVNLIIEPPAVRRGQHVVLRCMYDL 94

  Fly    83 ENDTLYSVKWYKGKREFYRYTPKENPAMKVFAMTSGLNVERNLSNQSHVVLQSVPLNISGKFTCE 147
            :...|||.|:|:|:.|||||||.|.|..|||.. .|::|:.:.||.:.|:|::|...:||.|:||
  Fly    95 DGAPLYSAKFYRGQLEFYRYTPGEFPNTKVFPF-PGIHVDVSSSNATQVLLRNVGFGLSGNFSCE 158

  Fly   148 ISVEAPTFQTAMVSGEMEVVELPEEHTVVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTINGIV 212
            ::.:||.|.||.....|:||||||:...|.....||..||::..|||...|:|.|.||:|||.:|
  Fly   159 VTADAPLFSTATAVDTMQVVELPEKRPQVFTEHTRYEPGDVLRANCSTPPSRPRAELTFTINNMV 223

  Fly   213 ---VPPHHIKTYQTEKRENSTLESVTSAIHFMVTNQHFLK----------------------GQM 252
               |...:|:|.........:|:.....|||...|.....                      |.:
  Fly   224 ITHVDTEYIRTIDNLIATRISLKMQLQGIHFSSVNPAIYNNVYGLNSVYGHGGPVYAPNSNPGGL 288

  Fly   253 RLKCTANIFDIFKEEMESVIEEDRPR 278
            .|:|:|.|.|:::|..|  ||...|:
  Fly   289 LLRCSAQIGDLYQEYKE--IELGTPQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 20/59 (34%)
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.