DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and beat-Vb

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster


Alignment Length:303 Identity:79/303 - (26%)
Similarity:135/303 - (44%) Gaps:55/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LILVPDFIEALKDVSVMIPQAVKRGSNALFTCNYDMENDTLYSVKWYKGKREFYRYTPKENPAMK 111
            ::||...|:.|:...:.:||.|....|...:|:||:...||.||||||..:||:||:|...|...
  Fly    14 MLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSPLTPPTYI 78

  Fly   112 VFAMTSGLNV--ERNLSNQS--HVVLQSVPLNISGKFTCEISVEAPTFQTAMVSGEMEVVELPEE 172
            .||: .|:.:  :.|..|:|  .|.|..:.:..||.:.||:|.:||.||.......|.|..||:.
  Fly    79 PFAV-EGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQN 142

  Fly   173 HTVVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTINGIVVP-PHHIKTYQTE-KRENSTLESVT 235
            :.:::...:.||..|.|:.|||..:|.....:||.:|||.|. ...:.:::|. .....::..:.
  Fly   143 NPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETTIVAHGYSMRRIV 207

  Fly   236 SAIHFMVTNQHFLKGQMRLKCTANIFDIFKEEMESVIEEDRP----------RIMASGRSYDINN 290
            |.::|......|                .:.:::.:|::.|.          |.:|     :|:.
  Fly   208 SQLNFYANEPRF----------------HQLQLQKLIQQKRTISPARLGLELRCVA-----EIDR 251

  Fly   291 YPLEEHTNGE--------RGGFEDHNESYLTYYSADNTASGAS 325
            ||   |...|        |...:..|:..:      |:.|||:
  Fly   252 YP---HLQREGTMFAQLFRDDIDQKNQKLI------NSRSGAT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 14/58 (24%)
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 31/82 (38%)
Ig 41..130 CDD:143165 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.