DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and beat-Vc

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001356887.1 Gene:beat-Vc / 41575 FlyBaseID:FBgn0038084 Length:297 Species:Drosophila melanogaster


Alignment Length:242 Identity:75/242 - (30%)
Similarity:118/242 - (48%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LVPDFIEALKDVSVMIPQAVKRGSNALFTCNYDMENDTLYSVKWYKGKREFYRYTPKENPAMKVF 113
            :.|...|.|...::.:|:.:.....|...|:|.|.|.||.||||||...||:||:|...|....|
  Fly    18 MAPVPAEGLHLSNLSVPRIIDVAQKAKLFCSYAMGNRTLNSVKWYKDGLEFFRYSPLTPPTTNWF 82

  Fly   114 AMTSGLNVERNL--SNQ--SHVVLQSVPLNISGKFTCEISVEAPTFQTAMVSGEMEVVELPEEHT 174
            .: .|:.:....  .||  .:|.|:.:..:.||::.||:|.:||.|:....:..|.|..||:...
  Fly    83 PV-KGVTIADGSPHCNQFICNVELEKLTAHSSGQYRCEVSGDAPEFKLIDQTANMTVGVLPKFDP 146

  Fly   175 VVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTINGIVVPPHHIKTYQTEKREN-STLESVTSAI 238
            .::|::..|:..|.::.|||.:.|.|.|.|||.||....|.|.::....|...| .......|.:
  Fly   147 FISGVRHAYKYHDYLEANCSTEMSSPMAKLTWYINNKTAPGHSLQPQINEVSRNVDGFHLFASHL 211

  Fly   239 HFM--VTNQHFL-KGQM-RLKCTANIFDIFKEEMESVIEEDRPRIMA 281
            |..  :.:|.|: |.:| .|:|||:|..:.....||.:   |..|:|
  Fly   212 HLRLHLDDQRFISKSEMLELRCTADIMGLAAVRRESRV---RTTILA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 17/59 (29%)
beat-VcNP_001356887.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.