DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and CG5597

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:198 Identity:39/198 - (19%)
Similarity:68/198 - (34%) Gaps:55/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LFTCNYDMENDTLY-SVKWYKGKREFYRY---TP----------------------KE------- 106
            :..|:|::|....: :||||:..:..|::   ||                      |:       
  Fly    43 ILDCDYEVEESPKFITVKWYRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQYSSLALI 107

  Fly   107 NPAM------KVFAMTSGLNVERNLSNQSHVVLQSVPLNISGK-------FTCEISVEAPTFQTA 158
            ||.:      |....|| ||...:......:.|::..|.:|.|       ..|.::...|.....
  Fly   108 NPTIATTGDYKCVVQTS-LNTFSSHQRVQVIDLRNYTLELSHKTIHNETQLNCTVTNVYPRPTIT 171

  Fly   159 MVSGEMEVV-------ELPEEHTVVTGIQARYRIGDLVDG-NCSIKYSKPAANLTWTINGIVVPP 215
            ::|.:|:||       |..|.:...:.:.|.|...|..|. .|.:.:.....|||..........
  Fly   172 IISNDMDVVKREPMVYENEEGYFDGSAVVAAYDTDDDPDAYQCVVSFEGYGKNLTTVATSAAAGR 236

  Fly   216 HHI 218
            .|:
  Fly   237 SHV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 6/31 (19%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.