DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and beat-IIIa

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster


Alignment Length:271 Identity:94/271 - (34%)
Similarity:141/271 - (52%) Gaps:11/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HMQMANRWRTEKDVGSHGSQ-------SGRSCICWISVVLLLILVPDFIEALKDVSVMIPQAVKR 70
            |.|:  |...|:..|:.|::       :..|...|..:.::|:|: |...:|....|.||..:.|
  Fly    24 HQQL--RMNMEQQDGTPGARKSATARTAATSLQIWYILHVILVLI-DISSSLTMTEVKIPNHIMR 85

  Fly    71 GSNALFTCNYDMENDTLYSVKWYKGKREFYRYTPKENPAMKVFAMTSGLNVERNLSNQSHVVLQS 135
            ..:|...|.|.::.::||||||||...|.|||.|::.|..:.|.: .|:|::...|:.:.::|:.
  Fly    86 LKSATLGCRYALDGESLYSVKWYKDGHEIYRYVPRDKPPGQSFPL-PGVNIDLRNSSDTQILLRR 149

  Fly   136 VPLNISGKFTCEISVEAPTFQTAMVSGEMEVVELPEEHTVVTGIQARYRIGDLVDGNCSIKYSKP 200
            |.|..||.:.||:|.|||.|.|...|..|.||..|.....:||.|.||:|||:|..||:...|||
  Fly   150 VTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKP 214

  Fly   201 AANLTWTINGIVVPPHHIKTYQTEKRENSTLESVTSAIHFMVTNQHFLKGQMRLKCTANIFDIFK 265
            ..:|:|.|||..|...|::.|.........||.....:.|.|.:.||..|.|:|||.|.|..::.
  Fly   215 VCHLSWLINGEPVQKTHLRQYDKVVVNRDGLEMARLGLEFRVRSFHFKHGDMKLKCVAKISSLYL 279

  Fly   266 EEMESVIEEDR 276
            :..|..:|.||
  Fly   280 QSNEESVESDR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 18/56 (32%)
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 38/96 (40%)
IG_like 88..182 CDD:214653 37/94 (39%)
Ig 188..>227 CDD:299845 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.