DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and f11r.2

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001076451.1 Gene:f11r.2 / 100005566 ZFINID:ZDB-GENE-060531-67 Length:294 Species:Danio rerio


Alignment Length:210 Identity:49/210 - (23%)
Similarity:71/210 - (33%) Gaps:79/210 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TEKDVGSHGSQSGRSCICWIS--------VVLLLILVPDFIEALKDVSVMIPQAVKRGSNALFTC 78
            |..|.|.:.        |.:|        .:.|::.||    ..|.|| .||.:|..|||...||
Zfish    94 TRADAGDYN--------CEVSGNGGYGENTIKLVVSVP----PSKPVS-SIPSSVTTGSNVRLTC 145

  Fly    79 NYDMENDTLYSVKWYK--------------------------GKREF-----------YRYTPKE 106
             :|.......:.:|||                          |..||           :.....|
Zfish   146 -FDPVGSPPSTYEWYKDNNLLPEDPTKFPIFKNLTYKMNAFNGNLEFLSVSKWDAGSYFCVASNE 209

  Fly   107 NPA--------MKVFAMTSG--LNVERNLSNQSHVVLQSVPLNISGKFTCEISVEAP--TFQTAM 159
            |..        |:|:.:.|.  |:|:.|||.::|        ||.||.|....:|..  .|....
Zfish   210 NGVSQHGDAVKMEVYDVDSSQVLDVKSNLSMETH--------NIPGKITNSHIMEKQYGVFMLQE 266

  Fly   160 VSGEMEVVELPEEHT 174
            |..::|:.:|..|.|
Zfish   267 VKLKLEIQKLELEVT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845
f11r.2NP_001076451.1 Ig 29..120 CDD:299845 6/33 (18%)
IG_like 29..120 CDD:214653 6/33 (18%)
Ig_2 132..212 CDD:290606 16/80 (20%)
IG_like 134..216 CDD:214653 15/82 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.