DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ic and jam2b

DIOPT Version :9

Sequence 1:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001121766.1 Gene:jam2b / 100005301 ZFINID:ZDB-GENE-080229-3 Length:306 Species:Danio rerio


Alignment Length:238 Identity:59/238 - (24%)
Similarity:96/238 - (40%) Gaps:60/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SVVLLLILVPDFIEALKDVSVMIPQA---VKRGSNALFTCNYDMENDTLYSVKWYK-GKREFYRY 102
            |.:||||.:|    :...|:|...:|   |...:||:.:|.:..|.:|...|:|.| ||...|.|
Zfish    19 SALLLLIYIP----SSDPVTVTTSKAKMDVHENTNAVLSCEFRTEKETNPRVEWKKRGKDVSYVY 79

  Fly   103 TPKENPAMKVFAMTSGLNVERNLSNQSHVVLQSVPLNISGKFTCEISVEAPTFQTAMVSGEMEVV 167
            ...:         .:|....|...:.:.:.|:.|....||.:.||::......:...||..:.|:
Zfish    80 FEGD---------FTGSYKGRASIDGATLTLRGVTQKDSGVYHCEVTARQDKIKLGEVSVTLSVL 135

  Fly   168 --------ELPEEHTVVTGIQARYRIGDLVDGNCSIKYSKPAANLTW--------TINGIVVPPH 216
                    |:||  .|:.|..|..        :|..|.|.|||..:|        |.|     ||
Zfish   136 VPPHAPTCEVPE--AVMRGFSAEL--------HCKDKLSVPAATYSWYKDNKPLNTAN-----PH 185

  Fly   217 HIKTYQTEKRENSTLESVTSAIHFMVTNQHFLKGQMRLKCTAN 259
            .:         :.||::.|.::.|...::.. :||.|  |.|:
Zfish   186 DV---------HYTLDTKTGSLKFKSVSKSD-EGQYR--CEAS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 15/64 (23%)
jam2bNP_001121766.1 Ig 44..135 CDD:299845 23/99 (23%)
IG_like 44..134 CDD:214653 23/98 (23%)
IGc2 154..220 CDD:197706 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.