DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and NUD1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_015018.3 Gene:NUD1 / 854555 SGDID:S000005900 Length:851 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:47/174 - (27%)
Similarity:78/174 - (44%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GLQFQYPPI---EKMDPILNSLTECQKLSLSSNMIE------KIT----GISGMKNLKVLSLARN 80
            |:|...|.:   ...|..:|:|.     .:.||:::      |||    .::|..:|:.|.|:.|
Yeast   494 GMQRLLPNVLVLNLSDNEMNTLE-----GIPSNVVQLFCSNNKITSAHCSLAGFHDLECLDLSYN 553

  Fly    81 NLKTLNGIEPLADTLEELWVSYNNIEKTKPLES--MKALRVFYISFNMIKDWTEFMRMGVPPNLS 143
            .|.|......|...|:|:.:|||:|:..:.:.|  ||.|.:.....|.|.|:.:.:       |:
Yeast   554 LLNTSLKFLSLCHHLQEVNLSYNSIQSLEGIGSSRMKKLNLSNNEINGIIDFEQLI-------LT 611

  Fly   144 EITFVGNPLN-ENMDQSAFTAEAVRR---LPNMK--KLDGEPVI 181
            ..:.||..|. |.:|.|......||.   ||.:|  .|:|.|::
Yeast   612 NNSVVGGWLTVEVLDLSNNNIIGVRNINCLPRLKVLNLNGNPLV 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 28/106 (26%)
LRR_4 48..90 CDD:289563 12/51 (24%)
leucine-rich repeat 50..71 CDD:275380 6/30 (20%)
LRR_8 51..105 CDD:290566 18/63 (29%)
leucine-rich repeat 72..94 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 8/22 (36%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
leucine-rich repeat 142..171 CDD:275380 10/32 (31%)
NUD1NP_015018.3 LRR <440..662 CDD:227223 47/174 (27%)
leucine-rich repeat 522..544 CDD:275380 4/21 (19%)
leucine-rich repeat 545..567 CDD:275380 7/21 (33%)
PPP1R42 557..784 CDD:411060 30/106 (28%)
leucine-rich repeat 568..588 CDD:275380 7/19 (37%)
leucine-rich repeat 589..621 CDD:275380 9/38 (24%)
leucine-rich repeat 622..643 CDD:275380 6/20 (30%)
leucine-rich repeat 699..738 CDD:275380
leucine-rich repeat 739..768 CDD:275380
leucine-rich repeat 794..806 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.