DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and LRRCC1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_016869409.1 Gene:LRRCC1 / 85444 HGNCID:29373 Length:1046 Species:Homo sapiens


Alignment Length:171 Identity:50/171 - (29%)
Similarity:74/171 - (43%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVS 101
            ||.:|.|.|    .|.|.||||.|.:|.|::.:..|..|:|:.|.:..:.|:|.|.: |..|.||
Human    58 IEAIDHIWN----LQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELIN-LTRLNVS 117

  Fly   102 YNNIEKTK---PLESMK-ALRVFYISFNMIKDWTEFMRMGVPPNLSEIT---------------F 147
            ||:|:...   ||..:| .||...:..|.|......::..|  .|..:|               .
Human   118 YNHIDDLSGLIPLHGIKHKLRYIDLHSNRIDSIHHLLQCMV--GLHFLTNLILEKDGDDNPVCRL 180

  Fly   148 VGNPLNE---NMDQSAFTAEAVRRLPNMKKLD-----GEPV 180
            .|..||.   ..:...:.|..::.||.::.||     ||||
Human   181 PGTSLNTVTLPSELRGYRAVILQTLPQLRILDCKNIFGEPV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 35/95 (37%)
LRR_4 48..90 CDD:289563 14/41 (34%)
leucine-rich repeat 50..71 CDD:275380 9/20 (45%)
LRR_8 51..105 CDD:290566 22/53 (42%)
leucine-rich repeat 72..94 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 10/24 (42%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 7/46 (15%)
LRRCC1XP_016869409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.