DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and SDS22

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_012728.1 Gene:SDS22 / 853641 SGDID:S000001676 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:44/175 - (25%)
Similarity:88/175 - (50%) Gaps:10/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDP-ILNSLTECQKLSLSSNMIEKITGISGMK 70
            ::::::|.|:.:...:....|:|..    .:..::| ....|:..:::.|..|.|.::..:..:|
Yeast   143 VQNSISKIENLSTLKSLKNLELGGN----KVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHPLK 203

  Fly    71 NLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMR 135
            |||:||:..|.||.:..:|.|.: ||||::|:|.|.|.:.||....|....::.|.|   |....
Yeast   204 NLKILSIQSNKLKKIENLEELTN-LEELYLSHNFITKIEGLEKNLKLTTLDVTSNKI---TSLEN 264

  Fly   136 MGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV 180
            :....||::|....|.::::.:.......|:.||..: .|:|.|:
Yeast   265 LNHLSNLTDIWASFNKIDQSFESLGENLSALSRLETI-YLEGNPI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 29/92 (32%)
LRR_4 48..90 CDD:289563 12/41 (29%)
leucine-rich repeat 50..71 CDD:275380 3/20 (15%)
LRR_8 51..105 CDD:290566 20/53 (38%)
leucine-rich repeat 72..94 CDD:275380 9/21 (43%)
leucine-rich repeat 95..116 CDD:275380 10/20 (50%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
leucine-rich repeat 142..171 CDD:275380 6/28 (21%)
SDS22NP_012728.1 inl_like_NEAT_1 <42..>174 CDD:411101 4/34 (12%)
leucine-rich repeat 44..67 CDD:275380
leucine-rich repeat 68..91 CDD:275380
leucine-rich repeat 92..114 CDD:275380
PPP1R42 112..332 CDD:411060 44/175 (25%)
leucine-rich repeat 115..136 CDD:275380
leucine-rich repeat 137..158 CDD:275380 2/14 (14%)
leucine-rich repeat 159..182 CDD:275380 4/26 (15%)
leucine-rich repeat 183..204 CDD:275380 3/20 (15%)
leucine-rich repeat 205..248 CDD:275380 19/43 (44%)
leucine-rich repeat 249..270 CDD:275380 4/23 (17%)
leucine-rich repeat 271..294 CDD:275380 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.