DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and AT1G48540

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	NP_175287.2	Gene:	AT1G48540 / 841275	AraportID:	AT1G48540	Length:	1063	Species:	Arabidopsis thaliana

Alignment Length:	141	Identity:	39/141 - (27%)
Similarity:	70/141 - (49%)	Gaps:	1/141 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    40 MDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNN 104
            ||..|..|...:.|.||.|...|:..:.....||.|.|..|:|:|::.:..::..|.:|.:..|.
plant   183 MDESLQLLPAAESLDLSRNKFVKVDNLRRCTKLKHLDLGFNHLRTVSYLSQVSCHLVKLVLRNNA 247

  Fly   105 IEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRL 169
            :...:.:|::|:|:...:|:|:|.:::|...:.....|.|:...|||:.......|.....| .|
plant   248 LTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARWYRAHVFSYV-AL 311

  Fly   170 PNMKKLDGEPV 180
            |:..||||:.:
plant   312 PDELKLDGKQI 322

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	25/88 (28%)
		LRR_4	48..90	CDD:289563	12/41 (29%)
		leucine-rich repeat	50..71	CDD:275380	5/20 (25%)
		LRR_8	51..105	CDD:290566	15/53 (28%)
		leucine-rich repeat	72..94	CDD:275380	7/21 (33%)
		leucine-rich repeat	95..116	CDD:275380	4/20 (20%)
		leucine-rich repeat	117..141	CDD:275380	5/23 (22%)
		leucine-rich repeat	142..171	CDD:275380	8/28 (29%)
AT1G48540	NP_175287.2	leucine-rich repeat	113..149	CDD:275380
		leucine-rich repeat	150..192	CDD:275380	4/8 (50%)
		LRR_RI	<189..297	CDD:238064	28/107 (26%)
		leucine-rich repeat	194..214	CDD:275378	5/19 (26%)
		leucine-rich repeat	215..237	CDD:275378	7/21 (33%)
		LRR_8	237..295	CDD:290566	14/57 (25%)
		leucine-rich repeat	238..259	CDD:275378	4/20 (20%)
		leucine-rich repeat	260..284	CDD:275378	5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	2	1.870