DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and DNAL1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_113615.2 Gene:DNAL1 / 83544 HGNCID:23247 Length:190 Species:Homo sapiens


Alignment Length:183 Identity:97/183 - (53%)
Similarity:135/183 - (73%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITG 65
            |:|.||:|:|||:||::..|..:.|.||.|..|.|||||||..|:.|..|:|||||:|.||||..
Human     1 MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIAN 65

  Fly    66 ISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDW 130
            ::|:|||::|||.|||:|.|||:|.:.|||||||:|||.|||.|.:..||.|::.|:|.|::|||
Human    66 LNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDW 130

  Fly   131 TEFMRMGVPPNLSEITFVGNPLNE-NMDQSAFTAEAVRRLPNMKKLDGEPVIR 182
            .||:::...|.|.::.||||||.| :..::.:..||.:|:|.:|||||.|||:
Human   131 AEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 53/91 (58%)
LRR_4 48..90 CDD:289563 25/41 (61%)
leucine-rich repeat 50..71 CDD:275380 12/20 (60%)
LRR_8 51..105 CDD:290566 35/53 (66%)
leucine-rich repeat 72..94 CDD:275380 12/21 (57%)
leucine-rich repeat 95..116 CDD:275380 13/20 (65%)
leucine-rich repeat 117..141 CDD:275380 9/23 (39%)
leucine-rich repeat 142..171 CDD:275380 11/29 (38%)
DNAL1NP_113615.2 LRR_4 49..89 CDD:289563 25/39 (64%)
LRR 1 49..70 12/20 (60%)
leucine-rich repeat 50..71 CDD:275378 12/20 (60%)
LRR_8 70..127 CDD:290566 34/56 (61%)
LRR 2 71..92 13/20 (65%)
leucine-rich repeat 72..90 CDD:275378 11/17 (65%)
LRR 3 94..115 13/20 (65%)
LRR_4 95..133 CDD:289563 21/37 (57%)
leucine-rich repeat 95..116 CDD:275382 13/20 (65%)
LRR 4 116..137 9/20 (45%)
leucine-rich repeat 117..140 CDD:275382 9/22 (41%)
leucine-rich repeat 142..172 CDD:275382 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146512
Domainoid 1 1.000 102 1.000 Domainoid score I6915
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56366
OrthoDB 1 1.010 - - D1395642at2759
OrthoFinder 1 1.000 - - FOG0006128
OrthoInspector 1 1.000 - - otm41035
orthoMCL 1 0.900 - - OOG6_103843
Panther 1 1.100 - - O PTHR15454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.