DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and lrrc9

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_017951824.1 Gene:lrrc9 / 780204 XenbaseID:XB-GENE-1011352 Length:1514 Species:Xenopus tropicalis


Alignment Length:186 Identity:50/186 - (26%)
Similarity:79/186 - (42%) Gaps:30/186 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPI-LNSLTECQKLSLSSNMIEKITG 65
            |:.|...:||:        |...:.|: |...|..|..:..: |..|...:.|.|..|.|..:.|
 Frog  1196 SRDTVYGEALS--------PVMQSLEV-LHLGYNGINSLPMLQLGRLRNLKSLYLQGNEISHVEG 1251

  Fly    66 ISGMKNLKVLSLARNNLKT--------LNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYI 122
            :..::.|:.|.|..|.:|.        ||.:..|  .|||     |.:.....|..:..||...|
 Frog  1252 LENLQFLRELVLDHNRIKAIAETSFAKLNSLVSL--NLEE-----NRLRDLNNLPPLLKLRKLLI 1309

  Fly   123 SFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAE-AVRRLPNMKKLDG 177
            ..|.|::.:|..::.|.|.|.|::..|||::    :..|... .|.||.|::.|||
 Frog  1310 GSNKIQEISEIEKLEVIPALVELSISGNPIS----RKPFLRNLLVVRLQNLQILDG 1361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 26/100 (26%)
LRR_4 48..90 CDD:289563 12/49 (24%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
LRR_8 51..105 CDD:290566 17/61 (28%)
leucine-rich repeat 72..94 CDD:275380 8/29 (28%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 7/23 (30%)
leucine-rich repeat 142..171 CDD:275380 9/29 (31%)
lrrc9XP_017951824.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.