DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and Lrriq1

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	XP_011241894.1	Gene:	Lrriq1 / 74978	MGIID:	1922228	Length:	1717	Species:	Mus musculus

Alignment Length:	113	Identity:	34/113 - (30%)
Similarity:	53/113 - (46%)	Gaps:	14/113 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    50 CQKLS------LSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKT 108
            |:.|.      |::|::..|.|..|..||:.|.|:.|.:..::|:|.| ..|:||.|.:|.:..|
Mouse   870 CENLENLSVVLLNNNLLTSIHGFDGCTNLQSLELSHNKITRISGLESL-KYLQELTVDHNQLIST 933

  Fly   109 KPLESMKALRVFYI--SFNMIKDWTEFMRMGVPPNLSEITFVGNPLNE 154
            |.|  .:|..:.|:  |.|.:.........|:   |..|...||.|.|
Mouse   934 KGL--CEAPTIVYLDCSHNHLTGIDGIGNCGL---LQIIKLQGNYLRE 976

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	27/86 (31%)
		LRR_4	48..90	CDD:289563	13/45 (29%)
		leucine-rich repeat	50..71	CDD:275380	7/26 (27%)
		LRR_8	51..105	CDD:290566	19/59 (32%)
		leucine-rich repeat	72..94	CDD:275380	7/21 (33%)
		leucine-rich repeat	95..116	CDD:275380	8/20 (40%)
		leucine-rich repeat	117..141	CDD:275380	4/25 (16%)
		leucine-rich repeat	142..171	CDD:275380	6/13 (46%)
Lrriq1	XP_011241894.1	PTZ00121	<173..657	CDD:173412
		internalin_A	808..>1056	CDD:380193	34/113 (30%)
		leucine-rich repeat	833..854	CDD:275380
		leucine-rich repeat	855..875	CDD:275380	2/4 (50%)
		leucine-rich repeat	876..897	CDD:275380	5/20 (25%)
		leucine-rich repeat	898..919	CDD:275380	7/21 (33%)
		leucine-rich repeat	920..941	CDD:275380	9/22 (41%)
		leucine-rich repeat	942..963	CDD:275380	3/20 (15%)
		leucine-rich repeat	964..982	CDD:275380	6/13 (46%)
		leucine-rich repeat	986..1009	CDD:275380
		leucine-rich repeat	1010..1031	CDD:275380
		leucine-rich repeat	1058..1084	CDD:275380
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR15454
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.000