DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Lrriq3

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_083214.2 Gene:Lrriq3 / 74435 MGIID:1921685 Length:633 Species:Mus musculus


Alignment Length:56 Identity:20/56 - (35%)
Similarity:25/56 - (44%) Gaps:12/56 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NSLTECQ---------KLSLSSNMIEKITG---ISGMKNLKVLSLARNNLKTLNGI 88
            |.||:.|         ||.|..|.|:.:..   .||:||||:|.|..|....|..|
Mouse    60 NFLTDIQPLQSCKKLIKLDLHGNQIKTLPDKNFWSGLKNLKLLYLHDNGFSKLKNI 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 20/56 (36%)
LRR_4 48..90 CDD:289563 18/53 (34%)
leucine-rich repeat 50..71 CDD:275380 8/32 (25%)
LRR_8 51..105 CDD:290566 17/50 (34%)
leucine-rich repeat 72..94 CDD:275380 7/17 (41%)
leucine-rich repeat 95..116 CDD:275380
leucine-rich repeat 117..141 CDD:275380
leucine-rich repeat 142..171 CDD:275380
Lrriq3NP_083214.2 LRR_8 51..109 CDD:338972 18/48 (38%)
LRR 1 51..72 4/11 (36%)
leucine-rich repeat 52..73 CDD:275378 4/12 (33%)
LRR 2 73..94 5/20 (25%)
leucine-rich repeat 74..98 CDD:275378 7/23 (30%)
LRR 3 98..119 8/18 (44%)
leucine-rich repeat 99..112 CDD:275378 5/12 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343
SidE <459..630 CDD:289056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.