powered by:
Protein Alignment CG10839 and Lrriq3
DIOPT Version :9
Sequence 1: | NP_001246039.1 |
Gene: | CG10839 / 34944 |
FlyBaseID: | FBgn0028858 |
Length: | 182 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_083214.2 |
Gene: | Lrriq3 / 74435 |
MGIID: | 1921685 |
Length: | 633 |
Species: | Mus musculus |
Alignment Length: | 56 |
Identity: | 20/56 - (35%) |
Similarity: | 25/56 - (44%) |
Gaps: | 12/56 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 NSLTECQ---------KLSLSSNMIEKITG---ISGMKNLKVLSLARNNLKTLNGI 88
|.||:.| ||.|..|.|:.:.. .||:||||:|.|..|....|..|
Mouse 60 NFLTDIQPLQSCKKLIKLDLHGNQIKTLPDKNFWSGLKNLKLLYLHDNGFSKLKNI 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0531 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.