DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Dnal1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006240414.1 Gene:Dnal1 / 685664 RGDID:1591349 Length:249 Species:Rattus norvegicus


Alignment Length:182 Identity:95/182 - (52%)
Similarity:134/182 - (73%) Gaps:1/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGI 66
            :|.||:|:||::||::..|..:.|.||.|..|.|||||||..|::|..|:|||||:|.||||..:
  Rat    61 AKATTIKEALSRWEEKTGQKPSDAREIKLYAQIPPIEKMDASLSTLANCEKLSLSTNCIEKIANL 125

  Fly    67 SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWT 131
            :|:|||::|||.|||:|.|||:|.:.|||||||:|||.|||.|.:..|:.|::.|||.|::|||.
  Rat   126 NGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMRKLKILYISNNLVKDWA 190

  Fly   132 EFMRMGVPPNLSEITFVGNPLNE-NMDQSAFTAEAVRRLPNMKKLDGEPVIR 182
            ||:::...|.|.::.||||||.| :..:..:..||.:|:|.:|||||.|||:
  Rat   191 EFVKLAELPCLEDLVFVGNPLEEKHSAEGNWIEEATKRVPKLKKLDGTPVIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 53/91 (58%)
LRR_4 48..90 CDD:289563 25/41 (61%)
leucine-rich repeat 50..71 CDD:275380 12/20 (60%)
LRR_8 51..105 CDD:290566 35/53 (66%)
leucine-rich repeat 72..94 CDD:275380 12/21 (57%)
leucine-rich repeat 95..116 CDD:275380 13/20 (65%)
leucine-rich repeat 117..141 CDD:275380 10/23 (43%)
leucine-rich repeat 142..171 CDD:275380 11/29 (38%)
Dnal1XP_006240414.1 LRR_4 108..148 CDD:289563 25/39 (64%)
leucine-rich repeat 109..129 CDD:275378 12/19 (63%)
LRR_8 129..186 CDD:290566 34/56 (61%)
leucine-rich repeat 131..175 CDD:275382 27/43 (63%)
LRR_4 154..192 CDD:289563 21/37 (57%)
leucine-rich repeat 176..199 CDD:275382 10/22 (45%)
leucine-rich repeat 201..231 CDD:275382 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340314
Domainoid 1 1.000 102 1.000 Domainoid score I6753
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56366
OrthoDB 1 1.010 - - D1395642at2759
OrthoFinder 1 1.000 - - FOG0006128
OrthoInspector 1 1.000 - - otm45171
orthoMCL 1 0.900 - - OOG6_103843
Panther 1 1.100 - - O PTHR15454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.