DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and Ppp1r7

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	NP_075689.1	Gene:	Ppp1r7 / 66385	MGIID:	1913635	Length:	361	Species:	Mus musculus

Alignment Length:	133	Identity:	33/133 - (24%)
Similarity:	74/133 - (55%)	Gaps:	4/133 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 LNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKT 108
            |::||....||:.||.:.||.|:..:.||:.|.|:.|.::.:.|:|. .:.|..|.::.|.|:|.
Mouse   227 LDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLEN-NNKLTMLDIASNRIKKI 290

  Fly   109 KPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMK 173
            :.:..:..|:.|:::.|:::.|::...:....:|..:....|||.::   ..:..:.:..||:::
Mouse   291 ENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKD---PQYRRKVMLALPSVR 352

  Fly   174 KLD 176
            ::|
Mouse   353 QID 355

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	25/84 (30%)
		LRR_4	48..90	CDD:289563	14/41 (34%)
		leucine-rich repeat	50..71	CDD:275380	7/20 (35%)
		LRR_8	51..105	CDD:290566	17/53 (32%)
		leucine-rich repeat	72..94	CDD:275380	6/21 (29%)
		leucine-rich repeat	95..116	CDD:275380	5/20 (25%)
		leucine-rich repeat	117..141	CDD:275380	4/23 (17%)
		leucine-rich repeat	142..171	CDD:275380	5/28 (18%)
Ppp1r7	NP_075689.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..64
		LRR 1	78..99
		LRR_4	99..140	CDD:289563
		LRR 2	100..121
		leucine-rich repeat	101..122	CDD:275380
		LRR_4	121..163	CDD:289563
		LRR_8	122..177	CDD:290566
		LRR 3	122..143
		leucine-rich repeat	123..144	CDD:275380
		LRR_4	143..185	CDD:289563
		LRR 4	144..165
		leucine-rich repeat	145..166	CDD:275380
		LRR_8	165..221	CDD:290566
		LRR 5	166..187
		leucine-rich repeat	167..188	CDD:275380
		LRR_4	188..227	CDD:289563	33/133 (25%)
		LRR 6	188..209
		leucine-rich repeat	189..210	CDD:275380
		LRR_4	209..251	CDD:289563	10/23 (43%)
		LRR 7	210..231		1/3 (33%)
		leucine-rich repeat	211..232	CDD:275380	2/4 (50%)
		LRR_8	231..287	CDD:290566	18/56 (32%)
		LRR 8	232..253		7/20 (35%)
		leucine-rich repeat	233..254	CDD:275380	7/20 (35%)
		LRR_4	254..295	CDD:289563	12/41 (29%)
		LRR 9	254..275		7/21 (33%)
		leucine-rich repeat	255..276	CDD:275380	6/21 (29%)
		LRR_4	276..317	CDD:289563	9/40 (23%)
		LRR 10	276..297		5/20 (25%)
		leucine-rich repeat	277..298	CDD:275380	5/20 (25%)
		LRR 11	298..319		4/20 (20%)
		LRRcap	337..355	CDD:197729	2/20 (10%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810