Sequence 1: | NP_001246039.1 | Gene: | CG10839 / 34944 | FlyBaseID: | FBgn0028858 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291864.1 | Gene: | lrriq1 / 565257 | ZFINID: | ZDB-GENE-050419-235 | Length: | 1511 | Species: | Danio rerio |
Alignment Length: | 279 | Identity: | 49/279 - (17%) |
---|---|---|---|
Similarity: | 87/279 - (31%) | Gaps: | 116/279 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 ALAKWEDRNKQPAATATEIGL----------QFQYPPIEKMDPILNSLT--ECQKLS------LS 56
Fly 57 SNMIEKITGISGMKNLKVLSLARNNLKTLNGIE-------------------------------- 89
Fly 90 -------------------------------------------------PLADTLEELW------ 99
Fly 100 --VSYNNIEKTKPLESMKALRVFYISFNMIKDWTEF-MRMGVPPNLSEITFVGNPLNENMDQSAF 161
Fly 162 TAEAVRRLPNMKKLDGEPV 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10839 | NP_001246039.1 | LRR_RI | <37..129 | CDD:238064 | 29/188 (15%) |
LRR_4 | 48..90 | CDD:289563 | 15/130 (12%) | ||
leucine-rich repeat | 50..71 | CDD:275380 | 7/26 (27%) | ||
LRR_8 | 51..105 | CDD:290566 | 19/148 (13%) | ||
leucine-rich repeat | 72..94 | CDD:275380 | 7/102 (7%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 7/28 (25%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 4/24 (17%) | ||
leucine-rich repeat | 142..171 | CDD:275380 | 7/28 (25%) | ||
lrriq1 | XP_009291864.1 | LRR_RI | 713..952 | CDD:238064 | 41/243 (17%) |
LRR_8 | 713..767 | CDD:290566 | 14/58 (24%) | ||
leucine-rich repeat | 714..735 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 736..756 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 755..811 | CDD:290566 | 12/55 (22%) | ||
leucine-rich repeat | 757..778 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 779..800 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 801..822 | CDD:275380 | 0/20 (0%) | ||
leucine-rich repeat | 823..844 | CDD:275380 | 0/20 (0%) | ||
leucine-rich repeat | 845..866 | CDD:275380 | 0/20 (0%) | ||
LRR_8 | 867..921 | CDD:290566 | 11/53 (21%) | ||
leucine-rich repeat | 867..890 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 891..912 | CDD:275380 | 5/20 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |