DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and lrrcc1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_690381.2 Gene:lrrcc1 / 561887 ZFINID:ZDB-GENE-041111-207 Length:997 Species:Danio rerio


Alignment Length:156 Identity:38/156 - (24%)
Similarity:71/156 - (45%) Gaps:18/156 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MDPILNSLTE------CQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEEL 98
            :|..::||.|      ...|:|..|.:.||.|::...:::.|.|:.|::..:.|:..|: :|..|
Zfish     9 IDKDISSLLEVSLNPSISSLNLHCNRLTKIEGLTTAWHIRHLDLSSNHICRIEGLASLS-SLRTL 72

  Fly    99 WVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRM-GVPPNLSEITFVGNPLNENMDQSAFT 162
            .:|.|.|.|.:.|:.:..|....:::|.|.|.|..:.: |....|..:....|    .:|.....
Zfish    73 NLSCNLITKVEGLDGLTNLTRLNLAYNQINDLTGLLYLHGANYKLKYLQLHSN----RLDSMNHL 133

  Fly   163 AEAVRRLPNMKKL----DG--EPVIR 182
            .:.:..|.|:|.:    ||  .||.:
Zfish   134 LQCMVGLQNLKYITLSKDGAENPVCK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 25/94 (27%)
LRR_4 48..90 CDD:289563 11/47 (23%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
LRR_8 51..105 CDD:290566 15/53 (28%)
leucine-rich repeat 72..94 CDD:275380 5/21 (24%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 6/24 (25%)
leucine-rich repeat 142..171 CDD:275380 4/28 (14%)
lrrcc1XP_690381.2 LRR_4 23..65 CDD:289563 10/41 (24%)
leucine-rich repeat 25..46 CDD:275378 6/20 (30%)
LRR_8 46..101 CDD:290566 14/55 (25%)
LRR_4 46..87 CDD:289563 12/41 (29%)
leucine-rich repeat 47..68 CDD:275378 5/21 (24%)
LRR_4 68..107 CDD:289563 12/38 (32%)
leucine-rich repeat 69..90 CDD:275378 7/20 (35%)
LRR_8 89..149 CDD:290566 12/63 (19%)
LRR_4 89..133 CDD:289563 9/47 (19%)
leucine-rich repeat 91..116 CDD:275378 6/24 (25%)
leucine-rich repeat 117..129 CDD:275378 2/15 (13%)
Rootletin 754..>869 CDD:291694
DUF342 <817..895 CDD:302792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.