DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and lrguk

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_021330922.1 Gene:lrguk / 559670 ZFINID:ZDB-GENE-050419-232 Length:739 Species:Danio rerio


Alignment Length:195 Identity:47/195 - (24%)
Similarity:78/195 - (40%) Gaps:45/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKT 84
            ||.....|:  .|.:..:..|.. |::.:...||.|..|....|.|:...|.|..||||.||:..
Zfish   100 QPPKNLKEV--NFSHNQMTAMKD-LSAYSSLTKLILDHNSFSVIRGLEKCKRLSHLSLAHNNISR 161

  Fly    85 LNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRM------GVPPN-- 141
            :.|::.|  .|.||.::.|.|.|.:.|:::..|:|..:|.|.|:..|....:      .:..|  
Zfish   162 IRGLDHL--PLRELCLAGNMINKIENLQTLHNLQVLDLSCNRIQSLTGLQNLRFLGTVNLESNLI 224

  Fly   142 --------------LSEITFVGNPLNEN----------------MDQSAFTAEAVRRLPNMKKLD 176
                          |.||..:.||:.::                :|:...|||  .::..:.|.|
Zfish   225 TEIKEAAHLHDLILLREINLLKNPVQDHDDYRIAVIFLLQHLILLDKQTVTAE--EKVAAVNKYD 287

  Fly   177  176
            Zfish   288  287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 30/91 (33%)
LRR_4 48..90 CDD:289563 15/41 (37%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
LRR_8 51..105 CDD:290566 20/53 (38%)
leucine-rich repeat 72..94 CDD:275380 9/21 (43%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 6/29 (21%)
leucine-rich repeat 142..171 CDD:275380 9/44 (20%)
lrgukXP_021330922.1 LRR <25..>247 CDD:227223 39/151 (26%)
leucine-rich repeat 61..82 CDD:275380
leucine-rich repeat 83..104 CDD:275380 2/3 (67%)
leucine-rich repeat 105..126 CDD:275380 4/23 (17%)
leucine-rich repeat 127..148 CDD:275380 6/20 (30%)
leucine-rich repeat 149..168 CDD:275380 8/18 (44%)
leucine-rich repeat 170..191 CDD:275380 7/20 (35%)
leucine-rich repeat 192..210 CDD:275380 6/17 (35%)
leucine-rich repeat 211..238 CDD:275380 1/26 (4%)
GMPK 326..449 CDD:238026
Herpes_ICP4_C 520..>739 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.