Sequence 1: | NP_001246039.1 | Gene: | CG10839 / 34944 | FlyBaseID: | FBgn0028858 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021330922.1 | Gene: | lrguk / 559670 | ZFINID: | ZDB-GENE-050419-232 | Length: | 739 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 47/195 - (24%) |
---|---|---|---|
Similarity: | 78/195 - (40%) | Gaps: | 45/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 QPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKT 84
Fly 85 LNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRM------GVPPN-- 141
Fly 142 --------------LSEITFVGNPLNEN----------------MDQSAFTAEAVRRLPNMKKLD 176
Fly 177 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10839 | NP_001246039.1 | LRR_RI | <37..129 | CDD:238064 | 30/91 (33%) |
LRR_4 | 48..90 | CDD:289563 | 15/41 (37%) | ||
leucine-rich repeat | 50..71 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 51..105 | CDD:290566 | 20/53 (38%) | ||
leucine-rich repeat | 72..94 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 6/29 (21%) | ||
leucine-rich repeat | 142..171 | CDD:275380 | 9/44 (20%) | ||
lrguk | XP_021330922.1 | LRR | <25..>247 | CDD:227223 | 39/151 (26%) |
leucine-rich repeat | 61..82 | CDD:275380 | |||
leucine-rich repeat | 83..104 | CDD:275380 | 2/3 (67%) | ||
leucine-rich repeat | 105..126 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 127..148 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 149..168 | CDD:275380 | 8/18 (44%) | ||
leucine-rich repeat | 170..191 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 192..210 | CDD:275380 | 6/17 (35%) | ||
leucine-rich repeat | 211..238 | CDD:275380 | 1/26 (4%) | ||
GMPK | 326..449 | CDD:238026 | |||
Herpes_ICP4_C | 520..>739 | CDD:332854 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |