DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and lrrc61

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	NP_001036219.1	Gene:	lrrc61 / 553439	ZFINID:	ZDB-GENE-060616-245	Length:	260	Species:	Danio rerio

Alignment Length:	143	Identity:	45/143 - (31%)
Similarity:	66/143 - (46%)	Gaps:	27/143 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 LNSLTEC---QKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLA--DTLEELWVSYN 103
            |..:.||   ::|.||.|.|..:..:|.::.|..|:|:.|.:..|   ||||  ::|:.|.|:.|
Zfish    45 LGCIGECINLERLDLSGNNITNLGPLSPLRRLLSLNLSANRISNL---EPLATCESLQSLNVAGN 106

  Fly   104 NIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRR 168
            .|.....|.|:|:||  .:....:||           |....|   ||:.:|........|.
Zfish   107 VISSVDNLHSLKSLR--RLENIRLKD-----------NTYNFT---NPVCKNPSYRPLILEI--- 152

  Fly   169 LPNMKKLDGEPVI 181
            .||||.||||.|:
Zfish   153 FPNMKVLDGERVV 165

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	28/89 (31%)
		LRR_4	48..90	CDD:289563	13/44 (30%)
		leucine-rich repeat	50..71	CDD:275380	7/23 (30%)
		LRR_8	51..105	CDD:290566	19/55 (35%)
		leucine-rich repeat	72..94	CDD:275380	9/23 (39%)
		leucine-rich repeat	95..116	CDD:275380	7/20 (35%)
		leucine-rich repeat	117..141	CDD:275380	4/23 (17%)
		leucine-rich repeat	142..171	CDD:275380	5/28 (18%)
lrrc61	NP_001036219.1	leucine-rich repeat	54..81	CDD:275378	8/26 (31%)
lrrc61	NP_001036219.1	leucine-rich repeat	98..122	CDD:275378	10/25 (40%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810