DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and dnal1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_012823845.1 Gene:dnal1 / 549066 XenbaseID:XB-GENE-983792 Length:201 Species:Xenopus tropicalis


Alignment Length:182 Identity:100/182 - (54%)
Similarity:134/182 - (73%) Gaps:1/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGI 66
            :|.||:|:||||||:|..|.|..|.|:.|..|.|||||||..|::|..|:|||||:|.||||..:
 Frog    11 AKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIANL 75

  Fly    67 SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWT 131
            :|:|.|::|||.|||:|.|||:|.:.:||||||:|||.|||.|.:..||.|:|.|:|.|::|||.
 Frog    76 NGLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWA 140

  Fly   132 EFMRMGVPPNLSEITFVGNPLNE-NMDQSAFTAEAVRRLPNMKKLDGEPVIR 182
            ||.::|..|.|.::.||||||.| :..:..:..|||:|||.:|||||.|||:
 Frog   141 EFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGNPVIK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 52/91 (57%)
LRR_4 48..90 CDD:289563 24/41 (59%)
leucine-rich repeat 50..71 CDD:275380 12/20 (60%)
LRR_8 51..105 CDD:290566 33/53 (62%)
leucine-rich repeat 72..94 CDD:275380 12/21 (57%)
leucine-rich repeat 95..116 CDD:275380 13/20 (65%)
leucine-rich repeat 117..141 CDD:275380 11/23 (48%)
leucine-rich repeat 142..171 CDD:275380 13/29 (45%)
dnal1XP_012823845.1 internalin_A 53..>163 CDD:380193 61/109 (56%)
leucine-rich repeat 59..80 CDD:275378 12/20 (60%)
leucine-rich repeat 81..99 CDD:275378 11/17 (65%)
leucine-rich repeat 104..125 CDD:275382 13/20 (65%)
leucine-rich repeat 126..149 CDD:275382 11/22 (50%)
leucine-rich repeat 151..181 CDD:275382 13/29 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56366
OrthoDB 1 1.010 - - D1395642at2759
OrthoFinder 1 1.000 - - FOG0006128
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.