DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and LRRC49

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	NP_001185946.1	Gene:	LRRC49 / 54839	HGNCID:	25965	Length:	691	Species:	Homo sapiens

Alignment Length:	136	Identity:	41/136 - (30%)
Similarity:	74/136 - (54%)	Gaps:	10/136 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 LNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARN---NLKTLNGIEPLADTLEELWVSYNNI 105
            |.:|.....|.|..|.|.||..|:.:..|:||:||||   ::..|||:    |:|.||.:.:|.|
Human   179 LENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGL----DSLTELNLRHNQI 239

  Fly   106 EKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLP 170
            ...:.::::..|:..::|||.|..:.....:....:||:|||.|||:.:   :|.:....::.:.
Human   240 TFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQ---ESWYKHTVLQNMM 301

  Fly   171 NMKKLD 176
            .:::||
Human   302 QLRQLD 307

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	30/87 (34%)
		LRR_4	48..90	CDD:289563	17/44 (39%)
		leucine-rich repeat	50..71	CDD:275380	7/20 (35%)
		LRR_8	51..105	CDD:290566	22/56 (39%)
		leucine-rich repeat	72..94	CDD:275380	10/24 (42%)
		leucine-rich repeat	95..116	CDD:275380	5/20 (25%)
		leucine-rich repeat	117..141	CDD:275380	5/23 (22%)
		leucine-rich repeat	142..171	CDD:275380	9/28 (32%)
LRRC49	NP_001185946.1	LRR_8	118..173	CDD:290566
		LRR_4	118..158	CDD:289563
		LRR 1	118..139
		leucine-rich repeat	119..140	CDD:275380
		LRR_4	139..181	CDD:289563	1/1 (100%)
		LRR 2	140..161
		leucine-rich repeat	141..162	CDD:275380
		LRR 3	162..183		1/3 (33%)
		LRR_4	163..203	CDD:289563	9/23 (39%)
		leucine-rich repeat	163..184	CDD:275380	2/4 (50%)
		LRR 4	184..205		7/20 (35%)
		leucine-rich repeat	185..206	CDD:275380	7/20 (35%)
		LRR_4	205..247	CDD:289563	16/45 (36%)
		LRR_8	206..261	CDD:290566	20/58 (34%)
		LRR 5	206..227		10/24 (42%)
		leucine-rich repeat	207..228	CDD:275380	10/24 (42%)
		LRR_4	228..268	CDD:289563	10/39 (26%)
		LRR 6	228..249		5/20 (25%)
		leucine-rich repeat	229..250	CDD:275380	5/20 (25%)
		LRR 7	250..271		5/20 (25%)
		leucine-rich repeat	251..275	CDD:275380	5/23 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	365..393
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR15454
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.910