DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and dnaaf11

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001002311.1 Gene:dnaaf11 / 432388 ZFINID:ZDB-GENE-040827-2 Length:440 Species:Danio rerio


Alignment Length:175 Identity:40/175 - (22%)
Similarity:83/175 - (47%) Gaps:28/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNL 72
            :|.:.:..:.|.....:..|:.|..|  .|::::.|.....:.:.|.|.:|:|.||..:..:|.|
Zfish     6 EDLIRRRAEHNNGEIFSLEELSLHQQ--DIQRIEHIHKWCRDLKILYLQNNLIPKIENVGRLKKL 68

  Fly    73 KVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMG 137
            :.|:||.||::.:..:|. .::|::|.::.|::.:...:|::|        .|:           
Zfish    69 EYLNLALNNIEVIENLEG-CESLQKLDLTVNSVGRLSSVETLK--------HNL----------- 113

  Fly   138 VPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPVIR 182
               :|.|:..||||..|   ...:....|..:|.::.|||:.:.|
Zfish   114 ---HLKELYLVGNPCAE---YQGYRQYVVATVPQLQSLDGKEISR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 22/91 (24%)
LRR_4 48..90 CDD:289563 13/41 (32%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
LRR_8 51..105 CDD:290566 17/53 (32%)
leucine-rich repeat 72..94 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 4/20 (20%)
leucine-rich repeat 117..141 CDD:275380 1/23 (4%)
leucine-rich repeat 142..171 CDD:275380 8/28 (29%)
dnaaf11NP_001002311.1 LRR 1 20..43 5/24 (21%)
leucine-rich repeat 23..45 CDD:275378 5/23 (22%)
LRR 2 44..65 6/20 (30%)
LRR_8 46..98 CDD:290566 16/52 (31%)
LRR_4 46..86 CDD:289563 13/39 (33%)
leucine-rich repeat 46..67 CDD:275378 6/20 (30%)
LRR 3 66..89 8/23 (35%)
leucine-rich repeat 68..89 CDD:275378 7/21 (33%)
leucine-rich repeat 90..114 CDD:275378 6/45 (13%)
LRR 4 90..110 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.