DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and sds22

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster


Alignment Length:175 Identity:46/175 - (26%)
Similarity:81/175 - (46%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGI 88
            |..|:| ..:...||.::.::|    .::|.|..|.|.||..:..:.||::|||..|.:..:..:
  Fly   152 TMLELG-DNKLKKIENIEMLVN----LRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENL 211

  Fly    89 EPLADTLEELWVSYNNI-------EKTK---------------PLESMKALRVFYISFNMIKDWT 131
            |.||: |.||:||.|.:       |.||               .||.::.|...:::.|.:.||.
  Fly   212 EKLAN-LRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWK 275

  Fly   132 EFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176
            :...:.|...|..|....|||.:::   .:.::....||.::|:|
  Fly   276 DIELLKVNKALQTIYLEYNPLAKDV---RYRSKLRDILPQLQKID 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 31/113 (27%)
LRR_4 48..90 CDD:289563 12/41 (29%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
LRR_8 51..105 CDD:290566 21/53 (40%)
leucine-rich repeat 72..94 CDD:275380 8/21 (38%)
leucine-rich repeat 95..116 CDD:275380 11/42 (26%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 6/28 (21%)
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566
leucine-rich repeat 63..84 CDD:275380
LRR_4 83..125 CDD:289563
leucine-rich repeat 85..106 CDD:275380
LRR_8 105..183 CDD:290566 9/35 (26%)
leucine-rich repeat 107..128 CDD:275380
LRR_4 128..168 CDD:289563 5/16 (31%)
leucine-rich repeat 129..150 CDD:275380
LRR_4 149..189 CDD:289563 12/41 (29%)
leucine-rich repeat 151..172 CDD:275380 5/20 (25%)
leucine-rich repeat 173..194 CDD:275380 6/20 (30%)
LRR_8 194..249 CDD:290566 18/55 (33%)
LRR_4 194..235 CDD:289563 15/41 (37%)
leucine-rich repeat 195..216 CDD:275380 7/20 (35%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.