DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and Lrrc56

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	NP_001020073.1	Gene:	Lrrc56 / 365389	RGDID:	1311654	Length:	548	Species:	Rattus norvegicus

Alignment Length:	138	Identity:	40/138 - (28%)
Similarity:	67/138 - (48%)	Gaps:	11/138 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    52 KLSLSSNMIEKITGI-SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMK 115
            :|.|:.:.:..:..: :.:..|:||.|||..|..|:||.... .|:||:||||||....||..::
  Rat    97 QLKLNHSCLGSLRDLGTSLGQLQVLWLARCGLTDLDGIGSFL-ALKELYVSYNNISDLSPLCLLE 160

  Fly   116 ALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGN---------PLNENMDQSAFTAEAVRRLPN 171
            .|.|..:..|.::|..:...:.:.|.|:.:|..||         |.|:......:.||..:.:|.
  Rat   161 QLEVLDLEGNNVEDLGQMRYLQLCPRLTTLTLEGNLVCLKPDPGPSNKAPQDYNYRAEVKKLIPQ 225

  Fly   172 MKKLDGEP 179
            :..||..|
  Rat   226 LHILDEVP 233

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	26/77 (34%)
		LRR_4	48..90	CDD:289563	12/38 (32%)
		leucine-rich repeat	50..71	CDD:275380	2/19 (11%)
		LRR_8	51..105	CDD:290566	19/53 (36%)
		leucine-rich repeat	72..94	CDD:275380	10/21 (48%)
		leucine-rich repeat	95..116	CDD:275380	11/20 (55%)
		leucine-rich repeat	117..141	CDD:275380	4/23 (17%)
		leucine-rich repeat	142..171	CDD:275380	8/37 (22%)
Lrrc56	NP_001020073.1	PPP1R42	91..233	CDD:411060	39/136 (29%)
		LRR 1	94..115		2/17 (12%)
		leucine-rich repeat	95..117	CDD:275380	2/19 (11%)
		LRR 2	117..138		10/20 (50%)
		leucine-rich repeat	118..139	CDD:275380	10/21 (48%)
		LRR 3	139..160		11/20 (55%)
		leucine-rich repeat	140..161	CDD:275380	11/20 (55%)
		LRR 4	161..182		4/20 (20%)
		leucine-rich repeat	162..186	CDD:275380	4/23 (17%)
		LRR 5	186..206		4/19 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	405..433
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810