DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and TbCMF46

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_609325.2 Gene:TbCMF46 / 34318 FlyBaseID:FBgn0032163 Length:566 Species:Drosophila melanogaster


Alignment Length:113 Identity:38/113 - (33%)
Similarity:58/113 - (51%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPL 91
            ::.|.|.|  |.:::. |..|.:.:||||.||.|.||..|..::||.:||:..|.:.|:.|||.|
  Fly   115 DLNLSFNY--ITRIEN-LEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERL 176

  Fly    92 --ADTLEELWVSYNNIEKTK--PLESMKALRVF----YISFNMIKDWT 131
              ..:|:.|.:..|.|.|..  || |:..:.:.    |..:..||..|
  Fly   177 RFVSSLKVLNLEGNPIAKQPDFPL-SLYVIAILPQLNYYEYVFIKTET 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 33/99 (33%)
LRR_4 48..90 CDD:289563 18/41 (44%)
leucine-rich repeat 50..71 CDD:275380 10/20 (50%)
LRR_8 51..105 CDD:290566 23/55 (42%)
leucine-rich repeat 72..94 CDD:275380 9/23 (39%)
leucine-rich repeat 95..116 CDD:275380 8/22 (36%)
leucine-rich repeat 117..141 CDD:275380 4/19 (21%)
leucine-rich repeat 142..171 CDD:275380
TbCMF46NP_609325.2 leucine-rich repeat 69..90 CDD:275378
LRR_8 89..145 CDD:290566 12/32 (38%)
LRR_4 89..131 CDD:289563 5/18 (28%)
leucine-rich repeat 91..112 CDD:275378
leucine-rich repeat 113..134 CDD:275378 6/21 (29%)
LRR_8 134..192 CDD:290566 23/57 (40%)
LRR_4 134..174 CDD:289563 17/39 (44%)
leucine-rich repeat 135..156 CDD:275378 10/20 (50%)
leucine-rich repeat 157..181 CDD:275378 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.