DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and CG9044

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001260114.1 Gene:CG9044 / 33825 FlyBaseID:FBgn0031752 Length:1318 Species:Drosophila melanogaster


Alignment Length:154 Identity:39/154 - (25%)
Similarity:67/154 - (43%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLA-DTL 95
            |.|..:..:|..|......|.|:|..|.:..:..|..:.:||.|.|:.|.|..|......| ..|
  Fly   173 FSYNSLRSVDTALEFAQHLQHLNLRHNKLTSVAAIKWLPHLKTLDLSYNCLTHLPQFHMEACKRL 237

  Fly    96 EELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSA 160
            :.|.:|.|.:|:...:..:.||....:|.|.:.:.::.:.:....:|..:...||||..|.....
  Fly   238 QLLNISNNYVEELLDVAKLDALYNLDLSDNCLLEHSQLLPLSALMSLIVLNLQGNPLACNPKHRQ 302

  Fly   161 FTAEAVRRLPNMKK--LDGEPVIR 182
            .||:.:.:.....|  ||.||:.:
  Fly   303 ATAQYLHKNSATVKFVLDFEPLTK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 24/92 (26%)
LRR_4 48..90 CDD:289563 12/41 (29%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
LRR_8 51..105 CDD:290566 17/54 (31%)
leucine-rich repeat 72..94 CDD:275380 8/22 (36%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 3/23 (13%)
leucine-rich repeat 142..171 CDD:275380 8/28 (29%)
CG9044NP_001260114.1 LIP1 6..96 CDD:292526
LRR_RI <102..302 CDD:238064 32/128 (25%)
leucine-rich repeat 168..190 CDD:275380 4/16 (25%)
LRR_4 189..229 CDD:289563 12/39 (31%)
LRR_8 190..245 CDD:290566 16/54 (30%)
leucine-rich repeat 191..212 CDD:275380 5/20 (25%)
leucine-rich repeat 213..236 CDD:275380 8/22 (36%)
leucine-rich repeat 237..258 CDD:275380 5/20 (25%)
leucine-rich repeat 259..283 CDD:275380 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.