DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Cntrl

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006234114.1 Gene:Cntrl / 311886 RGDID:1305317 Length:2336 Species:Rattus norvegicus


Alignment Length:183 Identity:45/183 - (24%)
Similarity:91/183 - (49%) Gaps:21/183 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQK---LSLSSNMIEKIT 64
            |..|.:|.||..:..|   .:.:.:.|.:|:|         :.:|.:|.|   |:||.|:|.||.
  Rat    89 KKLTKQDNLALVKSLN---LSLSKDGGKKFRY---------IENLEKCVKLEVLNLSYNLIAKIE 141

  Fly    65 GISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKP--LESMKALRVFYISFNMI 127
            .:..:..|:.|:|:.|.:..:.|:|.:.: |::|.::.|.||....  .:.:|:|||..:..|.|
  Rat   142 KVDKLLRLRELNLSYNKISKIEGLENMCN-LQKLNLAGNEIEHIPGWFSKKLKSLRVLNLKGNKI 205

  Fly   128 KDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV 180
            ....:..::....:|:.:|.:.||:   :....:....:..|.:::.|:|:||
  Rat   206 SSLQDVSKLKPLQDLTSLTLIDNPV---VALPHYLQFIIFHLRSLESLEGQPV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 27/96 (28%)
LRR_4 48..90 CDD:289563 14/44 (32%)
leucine-rich repeat 50..71 CDD:275380 9/23 (39%)
LRR_8 51..105 CDD:290566 17/56 (30%)
leucine-rich repeat 72..94 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 5/22 (23%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 5/28 (18%)
CntrlXP_006234114.1 PPP1R42 89..261 CDD:411060 45/183 (25%)
leucine-rich repeat 100..119 CDD:275378 4/30 (13%)
leucine-rich repeat 127..148 CDD:275380 7/20 (35%)
leucine-rich repeat 149..170 CDD:275380 6/20 (30%)
leucine-rich repeat 171..194 CDD:275380 5/22 (23%)
leucine-rich repeat 195..219 CDD:275380 5/23 (22%)
leucine-rich repeat 220..246 CDD:275380 5/28 (18%)
PTZ00108 <267..535 CDD:240271
SMC_prok_B <438..1120 CDD:274008
Drf_FH1 1238..>1300 CDD:399386
SMC_prok_B 1396..2215 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.