DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Lrrc49

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001127941.1 Gene:Lrrc49 / 300763 RGDID:1309466 Length:686 Species:Rattus norvegicus


Alignment Length:190 Identity:46/190 - (24%)
Similarity:85/190 - (44%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPL--- 91
            |.||:..|.::..|.| |.....|.|..|.||:|:|:|.:|:|:||.|.:|.:|.::.:|.|   
  Rat   117 LNFQHNFITRIQNISN-LQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNL 180

  Fly    92 ----------------------------------------ADTLEELWVSYNNIEKTKPLESMKA 116
                                                    .|:|.||.:.:|.|...:.::::..
  Rat   181 DVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPC 245

  Fly   117 LRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176
            |:..::|||.|..:.....:....:||:|||.|||:.:   :|.:....::.:..:::||
  Rat   246 LQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQ---ESWYKHTVLQNMMQLRQLD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 32/134 (24%)
LRR_4 48..90 CDD:289563 15/41 (37%)
leucine-rich repeat 50..71 CDD:275380 8/20 (40%)
LRR_8 51..105 CDD:290566 22/96 (23%)
leucine-rich repeat 72..94 CDD:275380 8/64 (13%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 9/28 (32%)
Lrrc49NP_001127941.1 leucine-rich repeat 94..111 CDD:275380
LRR_4 112..153 CDD:289563 14/36 (39%)
leucine-rich repeat 114..135 CDD:275380 7/18 (39%)
LRR_4 134..176 CDD:289563 15/41 (37%)
leucine-rich repeat 136..157 CDD:275380 8/20 (40%)
LRR_8 156..212 CDD:290566 9/55 (16%)
LRR_4 156..198 CDD:289563 9/41 (22%)
leucine-rich repeat 158..179 CDD:275380 8/20 (40%)
LRR_4 178..220 CDD:289563 0/41 (0%)
leucine-rich repeat 180..201 CDD:275380 0/20 (0%)
LRR_8 202..256 CDD:290566 10/53 (19%)
leucine-rich repeat 202..223 CDD:275380 0/20 (0%)
LRR_4 223..263 CDD:289563 10/39 (26%)
leucine-rich repeat 224..245 CDD:275380 5/20 (25%)
leucine-rich repeat 246..270 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.