DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and Lrrc9

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	XP_038967924.1	Gene:	Lrrc9 / 299129	RGDID:	1565716	Length:	1188	Species:	Rattus norvegicus

Alignment Length:	139	Identity:	39/139 - (28%)
Similarity:	69/139 - (49%)	Gaps:	19/139 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 LNSLTECQKLS---LSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNI 105
            ::.|..|.:|.   ::...||||.|:.|.:||:.|.|..|.:..:..:|.|. .||.||:::|.|
  Rat    69 ISGLETCLRLKELWIAECCIEKIEGLHGCRNLEKLYLYYNKISKIENLEKLI-KLEVLWLNHNTI 132

  Fly   106 EKTKPLESMKALRVFYISFNMIKDWTEFMRMG--VPPN--LSEITFVGNPLNENMDQSAFTAEAV 166
            ...:.|:::|.|:...::.|:|..      :|  :.||  |.::...||.:....|.:..|
  Rat   133 RNIEGLQTLKNLKDLNLAGNLISS------IGRCLDPNEQLEKLNLSGNQITSFKDLTNLT---- 187

  Fly   167 RRLPNMKKL 175
             :||.:|.|
  Rat   188 -KLPRLKDL 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	27/87 (31%)
		LRR_4	48..90	CDD:289563	13/44 (30%)
		leucine-rich repeat	50..71	CDD:275380	8/23 (35%)
		LRR_8	51..105	CDD:290566	19/56 (34%)
		leucine-rich repeat	72..94	CDD:275380	6/21 (29%)
		leucine-rich repeat	95..116	CDD:275380	7/20 (35%)
		leucine-rich repeat	117..141	CDD:275380	4/25 (16%)
		leucine-rich repeat	142..171	CDD:275380	6/28 (21%)
Lrrc9	XP_038967924.1	leucine-rich repeat	47..77	CDD:275380	2/7 (29%)
		leucine-rich repeat	78..99	CDD:275380	7/20 (35%)
		PPP1R42	85..236	CDD:411060	36/123 (29%)
		leucine-rich repeat	100..121	CDD:275380	6/21 (29%)
		leucine-rich repeat	122..143	CDD:275380	7/20 (35%)
		leucine-rich repeat	144..166	CDD:275380	6/27 (22%)
		leucine-rich repeat	167..191	CDD:275380	6/28 (21%)
		leucine-rich repeat	192..223	CDD:275380	2/4 (50%)
		internalin_A	685..>1014	CDD:380193
		leucine-rich repeat	689..708	CDD:275380
		leucine-rich repeat	709..730	CDD:275380
		leucine-rich repeat	731..752	CDD:275380
		leucine-rich repeat	753..779	CDD:275380
		leucine-rich repeat	780..806	CDD:275380
		leucine-rich repeat	807..865	CDD:275380
		leucine-rich repeat	866..901	CDD:275380
		PPP1R42	879..1057	CDD:411060
		leucine-rich repeat	902..923	CDD:275380
		leucine-rich repeat	924..945	CDD:275380
		leucine-rich repeat	946..969	CDD:275380
		leucine-rich repeat	992..1016	CDD:275380
		leucine-rich repeat	1017..1044	CDD:275380
		leucine-rich repeat	1045..1112	CDD:275380
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910