Sequence 1: | NP_001246039.1 | Gene: | CG10839 / 34944 | FlyBaseID: | FBgn0028858 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038967924.1 | Gene: | Lrrc9 / 299129 | RGDID: | 1565716 | Length: | 1188 | Species: | Rattus norvegicus |
Alignment Length: | 139 | Identity: | 39/139 - (28%) |
---|---|---|---|
Similarity: | 69/139 - (49%) | Gaps: | 19/139 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 LNSLTECQKLS---LSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNI 105
Fly 106 EKTKPLESMKALRVFYISFNMIKDWTEFMRMG--VPPN--LSEITFVGNPLNENMDQSAFTAEAV 166
Fly 167 RRLPNMKKL 175 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |