DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Lrrc43

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001163867.1 Gene:Lrrc43 / 288751 RGDID:1561461 Length:681 Species:Rattus norvegicus


Alignment Length:192 Identity:48/192 - (25%)
Similarity:76/192 - (39%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKDALAKWEDRNKQPAATATEIGLQ----FQY--------PPIEKMDPILNSLTECQKLSLSSNM 59
            |||:.|  |||..:..|....:.::    :.|        ..:..:|..:....:.::|.||:|.
  Rat    94 LKDSSA--EDRFLRELAIQNPLTIKDTFFYSYFRCLRVVDKGVSLVDKEILKFLKLEELVLSANK 156

  Fly    60 IEKITGISGMKNLKVLSLARN--------------NLKTLN-GIEPLADTLEELWVSYNNIEKTK 109
            |:.|...:....||||.|..|              ||:.|. |...|...||.|:|:.||.....
  Rat   157 IKDIDANNLPPTLKVLELYGNLIASMECLCSPPPPNLQHLGLGHNKLLGPLESLYVTSNNWPLLV 221

  Fly   110 PLESMKALRVFYISFNMIKDWTEFMRMGVP--PNLSEITFVGNPLNENMDQSAFTAEAVRRL 169
            .|:         :.||.:.| .:.|.:|:.  ..|..:...||||........||.:::.||
  Rat   222 SLD---------LGFNDLTD-LQSMILGLSTLKCLRLLVLQGNPLALVPYYRGFTVDSLARL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 27/106 (25%)
LRR_4 48..90 CDD:289563 16/56 (29%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
LRR_8 51..105 CDD:290566 22/68 (32%)
leucine-rich repeat 72..94 CDD:275380 11/36 (31%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 5/25 (20%)
leucine-rich repeat 142..171 CDD:275380 9/28 (32%)
Lrrc43NP_001163867.1 LRR_RI <146..254 CDD:238064 30/117 (26%)
LRR_8 146..203 CDD:290566 16/56 (29%)
LRR_4 146..187 CDD:289563 12/40 (30%)
leucine-rich repeat 147..168 CDD:275378 6/20 (30%)
leucine-rich repeat 169..192 CDD:275378 6/22 (27%)
LRR_8 191..256 CDD:290566 20/74 (27%)
leucine-rich repeat 193..219 CDD:275378 10/25 (40%)
leucine-rich repeat 220..245 CDD:275378 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.