DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Lrrc43

DIOPT Version :10

Sequence 1:NP_609776.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001163867.1 Gene:Lrrc43 / 288751 RGDID:1561461 Length:681 Species:Rattus norvegicus


Alignment Length:192 Identity:48/192 - (25%)
Similarity:76/192 - (39%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKDALAKWEDRNKQPAATATEIGLQ----FQY--------PPIEKMDPILNSLTECQKLSLSSNM 59
            |||:.|  |||..:..|....:.::    :.|        ..:..:|..:....:.::|.||:|.
  Rat    94 LKDSSA--EDRFLRELAIQNPLTIKDTFFYSYFRCLRVVDKGVSLVDKEILKFLKLEELVLSANK 156

  Fly    60 IEKITGISGMKNLKVLSLARN--------------NLKTLN-GIEPLADTLEELWVSYNNIEKTK 109
            |:.|...:....||||.|..|              ||:.|. |...|...||.|:|:.||.....
  Rat   157 IKDIDANNLPPTLKVLELYGNLIASMECLCSPPPPNLQHLGLGHNKLLGPLESLYVTSNNWPLLV 221

  Fly   110 PLESMKALRVFYISFNMIKDWTEFMRMGVP--PNLSEITFVGNPLNENMDQSAFTAEAVRRL 169
            .|:         :.||.:.| .:.|.:|:.  ..|..:...||||........||.:::.||
  Rat   222 SLD---------LGFNDLTD-LQSMILGLSTLKCLRLLVLQGNPLALVPYYRGFTVDSLARL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_609776.1 PPP1R42 <37..152 CDD:455733 33/131 (25%)
leucine-rich repeat 50..71 CDD:275380 6/20 (30%)
leucine-rich repeat 72..94 CDD:275380 11/36 (31%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 5/25 (20%)
leucine-rich repeat 142..171 CDD:275380 9/28 (32%)
Lrrc43NP_001163867.1 leucine-rich repeat 147..168 CDD:275378 6/20 (30%)
PPP1R42 150..289 CDD:455733 38/134 (28%)
leucine-rich repeat 169..192 CDD:275378 6/22 (27%)
leucine-rich repeat 193..219 CDD:275378 10/25 (40%)
leucine-rich repeat 220..245 CDD:275378 6/34 (18%)

Return to query results.
Submit another query.