DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and DNAAF11

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006716601.2 Gene:DNAAF11 / 23639 HGNCID:16725 Length:472 Species:Homo sapiens


Alignment Length:177 Identity:44/177 - (24%)
Similarity:76/177 - (42%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISG 68
            |...:|.:.:..:.|.....:..|:.|..|  .||:::.|.....:.:.|.|.:|:|.||..:|.
Human     8 PHVTEDLIRRNAEHNDCVIFSLEELSLHQQ--EIERLEHIDKWCRDLKILYLQNNLIGKIENVSK 70

  Fly    69 MKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEF 133
            :|.|:.|:||                       .|||||.:.||..:.|....::.|.|.:.:..
Human    71 LKKLEYLNLA-----------------------LNNIEKIENLEGCEELAKLDLTVNFIGELSSI 112

  Fly   134 MRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV 180
            ..:....:|.|:..:|||. .:.|.  :....|..||.:|.|||:.:
Human   113 KNLQHNIHLKELFLMGNPC-ASFDH--YREFVVATLPQLKWLDGKEI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 25/91 (27%)
LRR_4 48..90 CDD:289563 12/41 (29%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
LRR_8 51..105 CDD:290566 13/53 (25%)
leucine-rich repeat 72..94 CDD:275380 4/21 (19%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 3/23 (13%)
leucine-rich repeat 142..171 CDD:275380 8/28 (29%)
DNAAF11XP_006716601.2 LRR_RI <5..200 CDD:238064 44/177 (25%)
leucine-rich repeat 29..51 CDD:275378 6/23 (26%)
LRR_8 52..104 CDD:290566 20/74 (27%)
LRR_4 52..92 CDD:289563 18/62 (29%)
leucine-rich repeat 52..73 CDD:275378 7/20 (35%)
leucine-rich repeat 74..95 CDD:275378 11/43 (26%)
leucine-rich repeat 96..120 CDD:275378 3/23 (13%)
LRRcap 134..152 CDD:197729 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.