DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and sds-22

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_495653.1 Gene:sds-22 / 174266 WormBaseID:WBGene00011637 Length:326 Species:Caenorhabditis elegans


Alignment Length:167 Identity:45/167 - (26%)
Similarity:81/167 - (48%) Gaps:30/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YPPIEKM----------DPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGI 88
            :|.||::          .|.::||.....|.|..|.:.:|:.:..:.||..|.|:.|.::.:||:
 Worm    57 FPKIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQINGL 121

  Fly    89 EPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVG-NPL 152
            :.|. .||.|::..|.|||.:.||::..|::..:..|.||   :...:|...||.|: |:| |.:
 Worm   122 DKLT-KLETLYLVSNKIEKIENLEALTQLKLLELGDNRIK---KIENIGHLVNLDEL-FIGKNKI 181

  Fly   153 N-----ENMDQSAFTA---------EAVRRLPNMKKL 175
            .     |.:.:.:..:         |.|.:|.|:|:|
 Worm   182 RQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 29/101 (29%)
LRR_4 48..90 CDD:289563 11/41 (27%)
leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
LRR_8 51..105 CDD:290566 16/53 (30%)
leucine-rich repeat 72..94 CDD:275380 7/21 (33%)
leucine-rich repeat 95..116 CDD:275380 9/20 (45%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 9/43 (21%)
sds-22NP_495653.1 leucine-rich repeat 40..59 CDD:275380 0/1 (0%)
leucine-rich repeat 60..82 CDD:275380 5/21 (24%)
LRR_8 82..137 CDD:290566 16/55 (29%)
LRR_4 83..123 CDD:289563 11/39 (28%)
leucine-rich repeat 83..104 CDD:275380 4/20 (20%)
LRR_4 104..144 CDD:289563 15/40 (38%)
leucine-rich repeat 105..126 CDD:275380 7/21 (33%)
LRR_8 125..181 CDD:290566 20/60 (33%)
LRR_4 125..167 CDD:289563 13/45 (29%)
leucine-rich repeat 127..148 CDD:275380 9/20 (45%)
leucine-rich repeat 149..170 CDD:275380 5/23 (22%)
leucine-rich repeat 171..192 CDD:275380 6/21 (29%)
leucine-rich repeat 193..214 CDD:275380 3/20 (15%)
leucine-rich repeat 215..236 CDD:275380 2/4 (50%)
leucine-rich repeat 256..283 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.